PDB entry 6ew5

View 6ew5 on RCSB PDB site
Description: Human myelin protein P2 F57A mutant, monoclinic crystal form
Class: lipid transport
Keywords: fatty acid binding protein, beta barrel, portal region, LIPID TRANSPORT
Deposited on 2017-11-03, released 2018-07-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-11, with a file datestamp of 2018-07-06.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: myelin p2 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: PMP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02689 (1-132)
      • expression tag (0)
      • engineered mutation (58)
    Domains in SCOPe 2.07: d6ew5a1, d6ew5a2
  • Chain 'B':
    Compound: myelin p2 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: PMP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02689 (1-132)
      • expression tag (0)
      • engineered mutation (58)
    Domains in SCOPe 2.07: d6ew5b1, d6ew5b2
  • Chain 'C':
    Compound: myelin p2 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: PMP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02689 (1-132)
      • expression tag (0)
      • engineered mutation (58)
    Domains in SCOPe 2.07: d6ew5c1, d6ew5c2
  • Chain 'D':
    Compound: myelin p2 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: PMP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02689 (1-132)
      • expression tag (0)
      • engineered mutation (58)
    Domains in SCOPe 2.07: d6ew5d1, d6ew5d2
  • Heterogens: PLM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ew5A (A:)
    gmsnkflgtwklvssenfddymkalgvglatrklgnlakptviiskkgdiitirtestak
    nteisfklgqefeettadnrktksivtlqrgslnqvqrwdgkettikrklvngkmvaeck
    mkgvvctriyekv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ew5B (B:)
    gmsnkflgtwklvssenfddymkalgvglatrklgnlakptviiskkgdiitirtestak
    nteisfklgqefeettadnrktksivtlqrgslnqvqrwdgkettikrklvngkmvaeck
    mkgvvctriyekv
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ew5C (C:)
    gmsnkflgtwklvssenfddymkalgvglatrklgnlakptviiskkgdiitirtestak
    nteisfklgqefeettadnrktksivtlqrgslnqvqrwdgkettikrklvngkmvaeck
    mkgvvctriyekv
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ew5D (D:)
    gmsnkflgtwklvssenfddymkalgvglatrklgnlakptviiskkgdiitirtestak
    nteisfklgqefeettadnrktksivtlqrgslnqvqrwdgkettikrklvngkmvaeck
    mkgvvctriyekv