PDB entry 6ew2

View 6ew2 on RCSB PDB site
Description: Human myelin protein P2 F57A mutant, tetragonal crystal form
Class: lipid transport
Keywords: fatty acid binding protein, beta barrel, portal region, LIPID TRANSPORT
Deposited on 2017-11-03, released 2018-07-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-11, with a file datestamp of 2018-07-06.
Experiment type: XRAY
Resolution: 1.59 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: myelin p2 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: PMP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02689 (1-132)
      • expression tag (0)
      • engineered mutation (58)
    Domains in SCOPe 2.07: d6ew2a1, d6ew2a2
  • Heterogens: PLM, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ew2A (A:)
    gmsnkflgtwklvssenfddymkalgvglatrklgnlakptviiskkgdiitirtestak
    nteisfklgqefeettadnrktksivtlqrgslnqvqrwdgkettikrklvngkmvaeck
    mkgvvctriyekv