PDB entry 6ew1

View 6ew1 on RCSB PDB site
Description: Crystal structure of the Filamin A Ig-like domains 3-5 mutant P637Q
Class: cell adhesion
Keywords: Actin binding protein, CELL ADHESION
Deposited on 2017-11-03, released 2018-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-31, with a file datestamp of 2018-10-26.
Experiment type: XRAY
Resolution: 2.31 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Filamin-A
    Species: Homo sapiens [TaxId:9606]
    Gene: FLNA, FLN, FLN1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21333 (2-End)
      • expression tag (0-1)
      • engineered mutation (161)
    Domains in SCOPe 2.07: d6ew1a1, d6ew1a2, d6ew1a3, d6ew1a4
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ew1A (A:)
    smcnpsacravgrglqpkgvrvketadfkvytkgagsgelkvtvkgpkgeervkqkdlgd
    gvygfeyypmvpgtyivtitwggqnigrspfevkvgtecgnqkvrawgpgleggvvgksa
    dfvveaigddvgtlgfsvegpsqakiecddkgdgscdvrywqqeageyavhvlcnsedir
    lspfmadirdapqdfhpdrvkargpglektgvavnkpaeftvdakhggkaplrvqvqdne
    gcpvealvkdngngtyscsyvprkpvkhtamvswggvsipnspfrvnvgag
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ew1A (A:)
    smcnpsacravgrglqpkgvrvketadfkvytkgagsgelkvtvkgpkgeervkqkdlgd
    gvygfeyypmvpgtyivtitwggqnigrspfevkvgtecgnqkvrawgpgleggvvgksa
    dfvveaigddvgtlgfsvegpsqakiecddkgdgscdvrywqqeageyavhvlcnsedir
    lspfmadirdapqdfhpdrvkargpglektgvavnkpaeftvdakhggkaplrvqvqdne
    gcpvealvkdngngtyscsyvprkpvkhtamvswggvsipnspfrvnv