PDB entry 6evo

View 6evo on RCSB PDB site
Description: crystal structure the peptide-substrate-binding domain of human type ii collagen prolyl 4-hydroxylase complexed with pro-pro-gly-pro-arg- gly-pro-pro-gly.
Deposited on 2017-11-02, released 2018-09-12
The last revision was dated 2018-10-31, with a file datestamp of 2018-10-26.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Prolyl 4-hydroxylase subunit alpha-2
    Species: Homo sapiens [TaxId:9606]
    Gene: P4HA2, UNQ290/PRO330
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: pro-pro-gly-pro-arg-gly-pro-pro-gly
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 6EVO (0-8)
  • Heterogens: SO4, DMS, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6evoA (A:)
mhhhhhhmlsvddcfgmgrsaynegdyyhtvlwmeqvlkqldageeatttksqvldylsy
avfqlgdlhraleltrrllsldpsheraggnlryfeqlleee

    Sequence, based on observed residues (ATOM records):
    >6evoA (A:)
mlsvddcfgmgrsaynegdyyhtvlwmeqvlkqldageeatttksqvldylsyavfqlgd
lhraleltrrllsldpsheraggnlryfeqlleee

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >6evoC (C:)
ppgprgppg