PDB entry 6evl

View 6evl on RCSB PDB site
Description: Crystal structure of an unlignaded peptide-substrate-binding domain of human type II collagen prolyl 4-hydroxylase
Class: hydrolase
Keywords: tetratricopeptide repeat, collagen synthesis, prolyl 4-hydroxylase, HYDROLASE
Deposited on 2017-11-02, released 2018-09-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-10-31, with a file datestamp of 2018-10-26.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Prolyl 4-hydroxylase subunit alpha-2
    Species: Homo sapiens [TaxId:9606]
    Gene: P4HA2, UNQ290/PRO330
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6evla_
  • Heterogens: SO4, DMS, GLY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6evlA (A:)
    mhhhhhhmlsvddcfgmgrsaynegdyyhtvlwmeqvlkqldageeatttksqvldylsy
    avfqlgdlhraleltrrllsldpsheraggnlryfeqlleee
    

    Sequence, based on observed residues (ATOM records): (download)
    >6evlA (A:)
    mlsvddcfgmgrsaynegdyyhtvlwmeqvlkqldageeatttksqvldylsyavfqlgd
    lhraleltrrllsldpsheraggnlryfeqllee