PDB entry 6evl
View 6evl on RCSB PDB site
Description: Crystal structure of an unlignaded peptide-substrate-binding domain of human type II collagen prolyl 4-hydroxylase
Class: hydrolase
Keywords: tetratricopeptide repeat, collagen synthesis, prolyl 4-hydroxylase, HYDROLASE
Deposited on
2017-11-02, released
2018-09-12
The last revision prior to the SCOPe 2.08 freeze date was dated
2018-10-31, with a file datestamp of
2018-10-26.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: N/A
AEROSPACI score: 0.35
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Prolyl 4-hydroxylase subunit alpha-2
Species: Homo sapiens [TaxId:9606]
Gene: P4HA2, UNQ290/PRO330
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d6evla_ - Heterogens: SO4, DMS, GLY, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>6evlA (A:)
mhhhhhhmlsvddcfgmgrsaynegdyyhtvlwmeqvlkqldageeatttksqvldylsy
avfqlgdlhraleltrrllsldpsheraggnlryfeqlleee
Sequence, based on observed residues (ATOM records): (download)
>6evlA (A:)
mlsvddcfgmgrsaynegdyyhtvlwmeqvlkqldageeatttksqvldylsyavfqlgd
lhraleltrrllsldpsheraggnlryfeqllee