SCOPe 2.08: Structural Classification of Proteins

PDB entry 6evj

View 6evj on RCSB PDB site
Description: crystal structure of bat influenza a/h17n10 polymerase with viral rna promoter and capped rna primer
Deposited on 2017-11-01, released 2017-12-13
The last revision was dated 2019-02-20, with a file datestamp of 2019-02-15.
Experiment type: XRAY
Resolution: 3.9 Å
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Polymerase acidic protein
Species: Influenza A virus (A/little yellow-shouldered bat/Guatemala/060/2010(H17N10)) [TaxId:1129347]
Gene: PA
Database cross-references and differences (RAF-indexed):
- Uniprot H6QM92 (14-726)
  - expression tag (13)
  - expression tag (727)
Chain 'B':
Compound: RNA-directed RNA polymerase catalytic subunit
Species: Influenza A virus (A/little yellow-shouldered bat/Guatemala/060/2010(H17N10)) [TaxId:1129347]
Gene: Pb1
Database cross-references and differences (RAF-indexed):
- Uniprot H6QM91 (9-764)
  - expression tag (765)
Chain 'C':
Compound: Polymerase basic protein 2
Species: Influenza A virus (A/little yellow-shouldered bat/Guatemala/060/2010(H17N10)) [TaxId:1129347]
Gene: pb2
Database cross-references and differences (RAF-indexed):
- Uniprot H6QM90 (9-End)
  - expression tag (8)
Chain 'D':
Compound: Polymerase acidic protein
Species: Influenza A virus (A/little yellow-shouldered bat/Guatemala/060/2010(H17N10)) [TaxId:1129347]
Gene: PA
Database cross-references and differences (RAF-indexed):
- Uniprot H6QM92 (14-726)
  - expression tag (13)
  - expression tag (727)
Chain 'E':
Compound: RNA-directed RNA polymerase catalytic subunit
Species: Influenza A virus (A/little yellow-shouldered bat/Guatemala/060/2010(H17N10)) [TaxId:1129347]
Gene: Pb1
Database cross-references and differences (RAF-indexed):
- Uniprot H6QM91 (9-764)
  - expression tag (765)
Chain 'F':
Compound: Polymerase basic protein 2
Species: Influenza A virus (A/little yellow-shouldered bat/Guatemala/060/2010(H17N10)) [TaxId:1129347]
Gene: pb2
Database cross-references and differences (RAF-indexed):
- Uniprot H6QM90 (9-End)
  - expression tag (7-8)
Chain 'M':
Compound: RNA (5'-d(*(gdm))-r(p*ap*ap*u)-3')
Species: synthetic construct, synthetic [TaxId:32630]
Chain 'N':
Compound: RNA (5'-d(*(gdm))-r(p*ap*ap*u)-3')
Species: synthetic construct, synthetic [TaxId:32630]
Chain 'R':
Compound: RNA (5'-r(*up*ap*up*ap*cp*cp*up*cp*up*gp*cp*up*u)-3')
Species: Influenza A virus, synthetic [TaxId:11320]
Chain 'S':
Compound: RNA (5'-r(*up*ap*up*ap*cp*cp*up*cp*up*gp*cp*up*u)-3')
Species: Influenza A virus, synthetic [TaxId:11320]
Chain 'U':
Compound: RNA (5'-r(p*ap*gp*up*ap*gp*up*ap*ap*cp*ap*ap*gp*ap*gp*g)-3')
Species: Influenza A virus, synthetic [TaxId:11320]
Chain 'V':
Compound: RNA (5'-r(p*ap*gp*up*ap*gp*up*ap*ap*cp*ap*ap*gp*ap*gp*g)-3')
Species: Influenza A virus, synthetic [TaxId:11320]

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

Chain 'A':
Sequence, based on SEQRES records:

>6evjA (A:)
gshhhhhhhhgsgsmenfvrtnfnpmileraektmkeygenpqnegnkfaaisthmevcf
mysdfhfidlegntivkendddnamlkhrfeiiegqerniawtivnsicnmtenskprfl
pdlydyktnkfieigvtrrkvedyyyekasklkgenvyihifsfdgeematddeyildee
srariktrlfvlrqelataglwdsfrqsekgeetleeefsypptfqrlanqslppsfkdy
hqfkayvssfkangnieaklgamsekvnaqiesfdprtirelelpegkfctqrskfllmd
amklsvlnpahegegipmkdakacldtfwgwkkatiikkhekgvntnylmiweqllesik
emegkflnlkktnhlkwglgegqapekmdfedckevpdlfqykseppekrklaswiqsef
nkaseltnsnwiefdelgndvapiehiasrrrnfftaevsqcraseyimkavyintalln
ssctameeyqvipiitkcrdtsgqrrtnlygfiikgrshlrndtdvvnfislefsltdpr
neihkwekycvleigdmeirtsistimkpvylyvrtngtskikmkwgmemrrcllqslqq
vesmieaesavkekdmtepffrnrendwpigespqgiekgtigkvcrvllaksvfnsiya
saqlegfsaesrklllliqafrdnldpgtfdlkglyeaieeciindpwvllnaswfnsfl
kavqlsmgsgsgenlyfq