PDB entry 6evi

View 6evi on RCSB PDB site
Description: solution NMR structure of EB1 C terminus (191-260)
Class: protein binding
Keywords: End-binding protein, EB1, microtubules, SxIP, Microtubule-associated protein RP/EB family member 1, MAPRE1, APC-binding protein EB1, PROTEIN BINDING
Deposited on 2017-11-01, released 2018-02-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Microtubule-associated protein RP/EB family member 1
    Species: Mus musculus [TaxId:10090]
    Gene: MAPRE1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6evia_
  • Chain 'B':
    Compound: Microtubule-associated protein RP/EB family member 1
    Species: Mus musculus [TaxId:10090]
    Gene: MAPRE1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6evib_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6eviA (A:)
    deaaelmqqvkvlkltvedlekerdfyfgklrnielicqenegendpvlqrivdilyatd
    egfvipdegg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6eviB (B:)
    deaaelmqqvkvlkltvedlekerdfyfgklrnielicqenegendpvlqrivdilyatd
    egfvipdegg