PDB entry 6euw

View 6euw on RCSB PDB site
Description: crystal structure of the cap-binding domain of the pb2 subunit of influenza a/h5n1 polymerase bound to an azaindazole inhibitor
Deposited on 2017-10-31, released 2017-12-13
The last revision was dated 2018-02-07, with a file datestamp of 2018-02-02.
Experiment type: XRAY
Resolution: 1 Å
R-factor: N/A
AEROSPACI score: 0.81 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Polymerase basic protein 2
    Species: Influenza A virus (A/duck/Shantou/4610/2003(H5N1)) [TaxId:365107]
    Gene: pb2
    Database cross-references and differences (RAF-indexed):
  • Heterogens: BYB, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6euwA (A:)
grisssfsfggftfkrtsgssvkkeeevltgnlqtlkirvhegyeeftmvgrratailrk
atrrliqlivsgrdeqsiaeaiivamvfsqedcmikavrgdlnfgsglnpmhqllrhfqk
dakvlfqnwgiepidnvmgmigilpdmtpstemslrgvrvskm

    Sequence, based on observed residues (ATOM records):
    >6euwA (A:)
isssfsfggftfkrtsgssvkkeeevltgnlqtlkirvhegyeeftmvgrratailrkat
rrliqlivsgrdeqsiaeaiivamvfsqedcmikavrgdlnlnpmhqllrhfqkdakvlf
qnwgiepidnvmgmigilpdmtpstemslrgvrvsk