PDB entry 6eui

View 6eui on RCSB PDB site
Description: the gh43, beta 1,3 galactosidase, bt3683 with galactose
Deposited on 2017-10-30, released 2018-10-17
The last revision was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-glucanase
    Species: Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) [TaxId:226186]
    Gene: BT_3683
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GAL, CA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6euiA (A:)
    mgsshhhhhhssglvprgshmasqkekgiasgkvwrdtdgnvinahgggilfhegkyywf
    gehrpasgfvtekgincysstdlynwksegialavseeeghdiekgcimerpkviynakt
    gkfvmwlhlelkgqgygparaavavsdspagpyrfirsgrvnpgayplnmtrkerkmkwn
    peeykewwtpkwyeaiakgmfvkrdlkdgqmsrdmtlfvdddgkayhiyssednltlqia
    eladdylshtgkyirifpgghneapaifkkegtywmitsgctgwdpnkarlltadsmlge
    wkqlpnpcvgedadktfggqstyilplpekgqfffmadmwrpksladsryiwlpvqfddk
    gvpfikwmdrwnfd
    

    Sequence, based on observed residues (ATOM records):
    >6euiA (A:)
    iasgkvwrdtdgnvinahgggilfhegkyywfgehrpasgfvtekgincysstdlynwks
    egialavseeeghdiekgcimerpkviynaktgkfvmwlhlelkgqgygparaavavsds
    pagpyrfirsgrvnpgayplnmtrkerkmkwnpeeykewwtpkwyeaiakgmfvkrdlkd
    gqmsrdmtlfvdddgkayhiyssednltlqiaeladdylshtgkyirifpgghneapaif
    kkegtywmitsgctgwdpnkarlltadsmlgewkqlpnpcvgedadktfggqstyilplp
    ekgqfffmadmwrpksladsryiwlpvqfddkgvpfikwmdrwnf