PDB entry 6eud

View 6eud on RCSB PDB site
Description: crystal structure of e. coli dexh-box ntpase hrpb
Deposited on 2017-10-30, released 2018-09-12
The last revision was dated 2018-11-14, with a file datestamp of 2018-11-09.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent RNA helicase HrpB
    Species: Escherichia coli [TaxId:562]
    Gene: hrpB, yadO, b0148, JW0144
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37024 (3-End)
      • expression tag (0-2)
  • Heterogens: EDO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6eudA (A:)
    amamsslpvaavlpelltaldcapqvllsaptgagkstwlplqllahpgingkiillepr
    rlaarnvaqrlaellnekpgdtvgyrmraqncvgpntrlevvtegvltrmiqrdpelsgv
    glvildefherslqadlalallldvqqglrddlkllimsatldndrlqqmlpeapvvise
    grsfpverrylplpahqrfddavavataemlrqesgslllflpgvgeiqrvqeqlasrig
    sdvllcplygalslndqrkailpapqgmrkvvlatniaetsltiegirlvvdcaqervar
    fdprtgltrlitqrvsqasmtqragragrlepgislhliakeqaeraaaqsepeilqsdl
    sgllmellqwgcsdpaqmswldqppvvnllaakrllqmlgalegerlsaqgqkmaalgnd
    prlaamlvsaknddeaataakiaaileepprmgnsdlgvafsrnqpawqqrsqqllkrln
    vrggeadssliapllagafadriarrrgqdgryqlangmgamldandalsrhewliapll
    lqgsaspdarillallvdidelvqrcpqlvqqsdtvewddaqgtlkawrrlqigqltvkv
    qplakpsedelhqamlngirdkglsvlnwtaeaeqlrlrllcaakwlpeydwpavddesl
    laaletwllphmtgvhslrglksldiyqalrglldwgmqqrldselpahytvptgsriai
    ryhednppalavrmqemfgeatnptiaqgrvplvlellspaqrplqitrdlsdfwkgayr
    evqkemkgrypkhvwpddpantaptrrtkkys
    

    Sequence, based on observed residues (ATOM records):
    >6eudA (A:)
    amamsslpvaavlpelltaldcapqvllsaptgagkstwlplqllahpgingkiillepr
    rlaarnvaqrlaellnekpgdtvgyrmraqncvgpntrlevvtegvltrmiqrdpelsgv
    glvildefherslqadlalallldvqqglrddlkllimsatldndrlqqmlpeapvvise
    grsfpverrylplpahqrfddavavataemlrqesgslllflpgvgeiqrvqeqlasrig
    sdvllcplygalslndqrkailpapqgmrkvvlatniaetsltiegirlvvdcaqervar
    fdprtgltrlitqrvsqasmtqragragrlepgislhliakeqaeraaaqsepeilqsdl
    sgllmellqwgcsdpaqmswldqppvvnllaakrllqmlgalegerlsaqgqkmaalgnd
    prlaamlvsaknddeaataakiaaileepprmgnsdlgvafsrnqpawqqrsqqllkrln
    vrggeadssliapllagafadriarrrgqdgryqlangmgamldandalsrhewliapll
    lqgsaspdarillallvdidelvqrcpqlvqqsdtvewddaqgtlkawrrlqigqltvkv
    qplakpsedelhqamlngirdkglsvlnwtaeaeqlrlrllcaakwlpeydwpavddesl
    laaletwllphmtgvhslrglksldiyqalrglldwgmqqrldselpahytvptgsriai
    ryhednppalavrmqemfgeatnptiaqgrvplvlellspaqrplqitrdlsdfwkgayr
    evqkemkgrypkhvwpddpantaptrrt