PDB entry 6eu6

View 6eu6 on RCSB PDB site
Description: sensor amt protein
Deposited on 2017-10-28, released 2018-01-24
The last revision was dated 2019-02-20, with a file datestamp of 2019-02-15.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ammonium transporter
    Species: Kuenenia stuttgartiensis [TaxId:174633]
    Gene: amtb, kuste3690
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1Q357 (0-402)
      • expression tag (403-404)
  • Heterogens: MES, ZDM, LMT, NH4, SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6eu6A (A:)
    meniqininhlwvimaacmvflmqlgftsyetgfsqsknaisialrnlvdtlisslvffs
    vgfgfmfgksymgligidlffandlalhpntlsysffffqmvfastaatiltgaiaersg
    fipniagtafivaiiypifghwawgnlfspdqtgwlkelgfidfagatvvhsiggwfama
    aaimvgpridkynpdgssnriglhnvplatlgtfflwfgwfgfnggsllrvsvniglvil
    ntnmaaasagvsalifiyatrkrieagslftailaglvaitassnmvtpvsavaiglitg
    ilaiiaegfiektlkiddpvsaiavhgvggvigtlcvaifaqksyllaengsrmhqlgiq
    algvivafswsfglgmlfflclkkvkrlrvtpeeekrglnvaeaa