PDB entry 6eto

View 6eto on RCSB PDB site
Description: Atomic resolution structure of RNase A (data collection 5)
Class: hydrolase
Keywords: Raman microspectroscopy, ribonuclease, atomic resolution, radiation damage, photodamage, HYDROLASE
Deposited on 2017-10-27, released 2018-02-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-07-04, with a file datestamp of 2018-06-29.
Experiment type: XRAY
Resolution: 1.02 Å
R-factor: N/A
AEROSPACI score: 0.79 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ribonuclease pancreatic
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61823 (0-123)
  Domains in SCOPe 2.08: d6etoa_
• Heterogens: IPA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6etoA (A:)
  ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
  knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
  dasv