PDB entry 6etn

View 6etn on RCSB PDB site
Description: Atomic resolution structure of RNase A (data collection 4)
Class: hydrolase
Keywords: Raman microspectroscopy, ribonuclease, atomic resolution, radiation damage, photodamage, HYDROLASE
Deposited on 2017-10-27, released 2018-02-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-02-21, with a file datestamp of 2018-02-16.
Experiment type: XRAY
Resolution: 0.92 Å
R-factor: N/A
AEROSPACI score: 0.9 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonuclease pancreatic
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6etna_
  • Heterogens: IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6etnA (A:)
    ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
    knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
    dasv