PDB entry 6ete

View 6ete on RCSB PDB site
Description: Crystal structure of KDM4D with tetrazolhydrazide compound 5
Class: oxidoreductase
Keywords: KDM4D, ligand binding, Tetrazolylhydrazide, tetrazole, inhibitor design, cancer, epigenetics, oxidoreductase
Deposited on 2017-10-26, released 2019-02-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-20, with a file datestamp of 2019-02-15.
Experiment type: XRAY
Resolution: 1.47 Å
R-factor: N/A
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lysine-specific demethylase 4D
    Species: Homo sapiens [TaxId:9606]
    Gene: KDM4D, JHDM3D, JMJD2D
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6etea_
  • Heterogens: ZN, NI, EDO, SO4, BWK, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6eteA (A:)
    metmkskancaqnpncnimifhptkeefndfdkyiaymesqgahraglakiippkewkar
    etydniseiliatplqqvasgragvftqyhkkkkamtvgeyrhlanskkyqtpphqnfed
    lerkywknriynspiygadisgslfdentkqwnlghlgtiqdllekecgvviegvntpyl
    yfgmwkttfawhtedmdlysinylhlgepktwyvvppehgqrlerlarelfpgssrgcga
    flrhkvalisptvlkengipfnritqeagefmvtfpygyhagfnhgfncaeainfatprw
    idygkmasqcscgearvtfsmdafvrilqperydlwkrgqdr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6eteA (A:)
    aqnpncnimifhptkeefndfdkyiaymesqgahraglakiippkewkaretydniseil
    iatplqqvasgragvftqyhkkkkamtvgeyrhlanskkyqtpphqnfedlerkywknri
    ynspiygadisgslfdentkqwnlghlgtiqdllekecgvviegvntpylyfgmwkttfa
    whtedmdlysinylhlgepktwyvvppehgqrlerlarelfpgssrgcgaflrhkvalis
    ptvlkengipfnritqeagefmvtfpygyhagfnhgfncaeainfatprwidygkmasqc
    scgearvtfsmdafvrilqperydlwkrgq