PDB entry 6etb

View 6etb on RCSB PDB site
Description: Aerobic S262Y mutation of E. coli FLRD core
Class: oxidoreductase
Keywords: Flavorubredoxin, flavodiiron protein, diiron center, nitric oxide reductase, oxidoreductase
Deposited on 2017-10-26, released 2018-11-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-07, with a file datestamp of 2018-11-02.
Experiment type: XRAY
Resolution: 1.91 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: anaerobic nitric oxide reductase flavorubredoxin
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: norV, flrD, ygaI, ygaJ, ygaK, b2710, JW2680
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q46877
      • engineered mutation (261)
    Domains in SCOPe 2.07: d6etba1, d6etba2
  • Chain 'B':
    Compound: anaerobic nitric oxide reductase flavorubredoxin
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: norV, flrD, ygaI, ygaJ, ygaK, b2710, JW2680
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q46877
      • engineered mutation (261)
    Domains in SCOPe 2.07: d6etbb1, d6etbb2
  • Heterogens: FMN, FE, OXY, O, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6etbA (A:)
    msivvknnihwvgqrdwevrdfhgteyktlrgssynsylireeknvlidtvdhkfsrefv
    qnlrneidladidyivinhaeedhagaltelmaqipdtpiyctanaidsinghhhhpewn
    fnvvktgdtldigngkqlifvetpmlhwpdsmmtyltgdavlfsndafgqhycdehlfnd
    evdqtelfeqcqryyaniltpfsrlvtpkiteilgfnlpvdmiatshgvvwrdnptqive
    lylkwaadyqedritifydtmynntrmmadaiaqgiaetdprvavkifnvarsdkneilt
    nvfrskgvlvgtstmnnvmmpkiaglveemtglrfrnkrasafgshgwsggavdrlstrl
    qdagfemslslkakwrpdqdalklcrehgreiarqwalaplpqstvntvvke
    

    Sequence, based on observed residues (ATOM records): (download)
    >6etbA (A:)
    sivvknnihwvgqrdwevrdfhgteyktlrgssynsylireeknvlidtvdhkfsrefvq
    nlrneidladidyivinhaeedhagaltelmaqipdtpiyctanaidsinghhhhpewnf
    nvvktgdtldigngkqlifvetpmlhwpdsmmtyltgdavlfsndafgqhycdehlfnde
    vdqtelfeqcqryyaniltpfsrlvtpkiteilgfnlpvdmiatshgvvwrdnptqivel
    ylkwaadyqedritifydtmynntrmmadaiaqgiaetdprvavkifnvarsdkneiltn
    vfrskgvlvgtstmnnvmmpkiaglveemtglrfrnkrasafgshgwsggavdrlstrlq
    dagfemslslkakwrpdqdalklcrehgreiarqwalapl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6etbB (B:)
    msivvknnihwvgqrdwevrdfhgteyktlrgssynsylireeknvlidtvdhkfsrefv
    qnlrneidladidyivinhaeedhagaltelmaqipdtpiyctanaidsinghhhhpewn
    fnvvktgdtldigngkqlifvetpmlhwpdsmmtyltgdavlfsndafgqhycdehlfnd
    evdqtelfeqcqryyaniltpfsrlvtpkiteilgfnlpvdmiatshgvvwrdnptqive
    lylkwaadyqedritifydtmynntrmmadaiaqgiaetdprvavkifnvarsdkneilt
    nvfrskgvlvgtstmnnvmmpkiaglveemtglrfrnkrasafgshgwsggavdrlstrl
    qdagfemslslkakwrpdqdalklcrehgreiarqwalaplpqstvntvvke
    

    Sequence, based on observed residues (ATOM records): (download)
    >6etbB (B:)
    sivvknnihwvgqrdwevrdfhgteyktlrgssynsylireeknvlidtvdhkfsrefvq
    nlrneidladidyivinhaeedhagaltelmaqipdtpiyctanaidsinghhhhpewnf
    nvvktgdtldigngkqlifvetpmlhwpdsmmtyltgdavlfsndafgqhycdehlfnde
    vdqtelfeqcqryyaniltpfsrlvtpkiteilgfnlpvdmiatshgvvwrdnptqivel
    ylkwaadyqedritifydtmynntrmmadaiaqgiaetdprvavkifnvarsdkneiltn
    vfrskgvlvgtstmnnvmmpkiaglveemtglrfrnkrasafgshgwsggavdrlstrlq
    dagfemslslkakwrpdqdalklcrehgreiarqwalapl