PDB entry 6et5

View 6et5 on RCSB PDB site
Description: Reaction centre light harvesting complex 1 from Blc. virids
Class: photosynthesis
Keywords: Reaction centre light harvesting complex 1 Blc. viridis Cryo-EM RC-LH1 Photosynthesis, PHOTOSYNTHESIS
Deposited on 2017-10-25, released 2018-04-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-10-23, with a file datestamp of 2019-10-18.
Experiment type: EM
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: Light-harvesting protein B-1015 beta chain
    Species: BLASTOCHLORIS VIRIDIS [TaxId:1079]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6et51_
  • Chain '2':
    Compound: Light-harvesting protein B-1015 gamma chain
    Species: BLASTOCHLORIS VIRIDIS [TaxId:1079]
    Database cross-references and differences (RAF-indexed):
  • Chain '3':
    Compound: Light-harvesting protein B-1015 alpha chain
    Species: BLASTOCHLORIS VIRIDIS [TaxId:1079]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6et53_
  • Chain '4':
    Compound: Light-harvesting protein B-1015 beta chain
    Species: BLASTOCHLORIS VIRIDIS [TaxId:1079]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6et54_
  • Chain '5':
    Compound: Light-harvesting protein B-1015 gamma chain
    Species: BLASTOCHLORIS VIRIDIS [TaxId:1079]
    Database cross-references and differences (RAF-indexed):
  • Chain '6':
    Compound: Light-harvesting protein B-1015 alpha chain
    Species: BLASTOCHLORIS VIRIDIS [TaxId:1079]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6et56_
  • Chain '7':
    Compound: Light-harvesting protein B-1015 beta chain
    Species: BLASTOCHLORIS VIRIDIS [TaxId:1079]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6et57_
  • Chain 'C':
    Compound: Photosynthetic reaction center cytochrome c subunit
    Species: BLASTOCHLORIS VIRIDIS [TaxId:1079]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6et5c_
  • Chain 'F':
    Compound: Light-harvesting protein B-1015 alpha chain
    Species: BLASTOCHLORIS VIRIDIS [TaxId:1079]
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Light-harvesting protein B-1015 beta chain
    Species: BLASTOCHLORIS VIRIDIS [TaxId:1079]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6et5g_
  • Chain 'H':
    Compound: reaction center protein h chain
    Species: BLASTOCHLORIS VIRIDIS [TaxId:1079]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6et5h1, d6et5h2
  • Chain 'I':
    Compound: Light-harvesting protein B-1015 gamma chain
    Species: BLASTOCHLORIS VIRIDIS [TaxId:1079]
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: Light-harvesting protein B-1015 alpha chain
    Species: BLASTOCHLORIS VIRIDIS [TaxId:1079]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6et5k_
  • Chain 'L':
    Compound: reaction center protein l chain
    Species: BLASTOCHLORIS VIRIDIS [TaxId:1079]
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: reaction center protein m chain
    Species: BLASTOCHLORIS VIRIDIS [TaxId:1079]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6et5m_
  • Chain 'N':
    Compound: Light-harvesting protein B-1015 beta chain
    Species: BLASTOCHLORIS VIRIDIS [TaxId:1079]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6et5n_
  • Chain 'O':
    Compound: Light-harvesting protein B-1015 gamma chain
    Species: BLASTOCHLORIS VIRIDIS [TaxId:1079]
    Database cross-references and differences (RAF-indexed):
  • Chain 'P':
    Compound: Light-harvesting protein B-1015 alpha chain
    Species: BLASTOCHLORIS VIRIDIS [TaxId:1079]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6et5p_
  • Chain 'Q':
    Compound: Light-harvesting protein B-1015 beta chain
    Species: BLASTOCHLORIS VIRIDIS [TaxId:1079]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6et5q_
  • Chain 'R':
    Compound: Light-harvesting protein B-1015 gamma chain
    Species: BLASTOCHLORIS VIRIDIS [TaxId:1079]
    Database cross-references and differences (RAF-indexed):
  • Chain 'S':
    Compound: Light-harvesting protein B-1015 alpha chain
    Species: BLASTOCHLORIS VIRIDIS [TaxId:1079]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6et5s_
  • Chain 'T':
    Compound: Light-harvesting protein B-1015 beta chain
    Species: BLASTOCHLORIS VIRIDIS [TaxId:1079]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6et5t_
  • Chain 'U':
    Compound: Light-harvesting protein B-1015 gamma chain
    Species: BLASTOCHLORIS VIRIDIS [TaxId:1079]
    Database cross-references and differences (RAF-indexed):
  • Chain 'V':
    Compound: Light-harvesting protein B-1015 alpha chain
    Species: BLASTOCHLORIS VIRIDIS [TaxId:1079]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6et5v_
  • Chain 'W':
    Compound: Light-harvesting protein B-1015 beta chain
    Species: BLASTOCHLORIS VIRIDIS [TaxId:1079]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6et5w_
  • Chain 'X':
    Compound: Light-harvesting protein B-1015 gamma chain
    Species: BLASTOCHLORIS VIRIDIS [TaxId:1079]
    Database cross-references and differences (RAF-indexed):
  • Chain 'Y':
    Compound: Light-harvesting protein B-1015 alpha chain
    Species: BLASTOCHLORIS VIRIDIS [TaxId:1079]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6et5y_
  • Chain 'Z':
    Compound: Light-harvesting protein B-1015 beta chain
    Species: BLASTOCHLORIS VIRIDIS [TaxId:1079]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6et5z_
  • Chain 'a':
    Compound: Light-harvesting protein B-1015 gamma chain
    Species: BLASTOCHLORIS VIRIDIS [TaxId:1079]
    Database cross-references and differences (RAF-indexed):
  • Chain 'b':
    Compound: Light-harvesting protein B-1015 alpha chain
    Species: BLASTOCHLORIS VIRIDIS [TaxId:1079]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6et5b_
  • Chain 'c':
    Compound: Light-harvesting protein B-1015 beta chain
    Species: BLASTOCHLORIS VIRIDIS [TaxId:1079]
    Database cross-references and differences (RAF-indexed):
  • Chain 'd':
    Compound: Light-harvesting protein B-1015 gamma chain
    Species: BLASTOCHLORIS VIRIDIS [TaxId:1079]
    Database cross-references and differences (RAF-indexed):
  • Chain 'e':
    Compound: Light-harvesting protein B-1015 alpha chain
    Species: BLASTOCHLORIS VIRIDIS [TaxId:1079]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6et5e_
  • Chain 'f':
    Compound: Light-harvesting protein B-1015 beta chain
    Species: BLASTOCHLORIS VIRIDIS [TaxId:1079]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6et5f_
  • Chain 'g':
    Compound: Light-harvesting protein B-1015 gamma chain
    Species: BLASTOCHLORIS VIRIDIS [TaxId:1079]
    Database cross-references and differences (RAF-indexed):
  • Chain 'h':
    Compound: Light-harvesting protein B-1015 alpha chain
    Species: BLASTOCHLORIS VIRIDIS [TaxId:1079]
    Database cross-references and differences (RAF-indexed):
  • Chain 'i':
    Compound: Light-harvesting protein B-1015 beta chain
    Species: BLASTOCHLORIS VIRIDIS [TaxId:1079]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6et5i_
  • Chain 'j':
    Compound: Light-harvesting protein B-1015 gamma chain
    Species: BLASTOCHLORIS VIRIDIS [TaxId:1079]
    Database cross-references and differences (RAF-indexed):
  • Chain 'k':
    Compound: Light-harvesting protein B-1015 alpha chain
    Species: BLASTOCHLORIS VIRIDIS [TaxId:1079]
    Database cross-references and differences (RAF-indexed):
  • Chain 'l':
    Compound: Light-harvesting protein B-1015 beta chain
    Species: BLASTOCHLORIS VIRIDIS [TaxId:1079]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6et5l_
  • Chain 'm':
    Compound: Light-harvesting protein B-1015 gamma chain
    Species: BLASTOCHLORIS VIRIDIS [TaxId:1079]
    Database cross-references and differences (RAF-indexed):
  • Chain 'n':
    Compound: Light-harvesting protein B-1015 alpha chain
    Species: BLASTOCHLORIS VIRIDIS [TaxId:1079]
    Database cross-references and differences (RAF-indexed):
  • Chain 'o':
    Compound: Light-harvesting protein B-1015 beta chain
    Species: BLASTOCHLORIS VIRIDIS [TaxId:1079]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6et5o_
  • Chain 'p':
    Compound: Light-harvesting protein B-1015 gamma chain
    Species: BLASTOCHLORIS VIRIDIS [TaxId:1079]
    Database cross-references and differences (RAF-indexed):
  • Chain 'q':
    Compound: Light-harvesting protein B-1015 alpha chain
    Species: BLASTOCHLORIS VIRIDIS [TaxId:1079]
    Database cross-references and differences (RAF-indexed):
  • Chain 'r':
    Compound: Light-harvesting protein B-1015 beta chain
    Species: BLASTOCHLORIS VIRIDIS [TaxId:1079]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6et5r_
  • Chain 's':
    Compound: Light-harvesting protein B-1015 gamma chain
    Species: BLASTOCHLORIS VIRIDIS [TaxId:1079]
    Database cross-references and differences (RAF-indexed):
  • Chain 't':
    Compound: Light-harvesting protein B-1015 alpha chain
    Species: BLASTOCHLORIS VIRIDIS [TaxId:1079]
    Database cross-references and differences (RAF-indexed):
  • Chain 'u':
    Compound: Light-harvesting protein B-1015 beta chain
    Species: BLASTOCHLORIS VIRIDIS [TaxId:1079]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6et5u_
  • Chain 'v':
    Compound: Light-harvesting protein B-1015 gamma chain
    Species: BLASTOCHLORIS VIRIDIS [TaxId:1079]
    Database cross-references and differences (RAF-indexed):
  • Chain 'w':
    Compound: Light-harvesting protein B-1015 alpha chain
    Species: BLASTOCHLORIS VIRIDIS [TaxId:1079]
    Database cross-references and differences (RAF-indexed):
  • Chain 'x':
    Compound: Light-harvesting protein B-1015 beta chain
    Species: BLASTOCHLORIS VIRIDIS [TaxId:1079]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6et5x_
  • Chain 'y':
    Compound: Light-harvesting protein B-1015 gamma chain
    Species: BLASTOCHLORIS VIRIDIS [TaxId:1079]
    Database cross-references and differences (RAF-indexed):
  • Chain 'z':
    Compound: Light-harvesting protein B-1015 alpha chain
    Species: BLASTOCHLORIS VIRIDIS [TaxId:1079]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HEM, BCB, BPB, UQ9, FE, SO4, LDA, MQ9, NS5, NS0

PDB Chain Sequences:

  • Chain '1':
    Sequence, based on SEQRES records: (download)
    >6et51 (1:)
    madlkpsltglteeeakefhgifvtstvlylatavivhylvwtarpwiapipkgwv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6et51 (1:)
    adlkpsltglteeeakefhgifvtstvlylatavivhylvwtarpwiapipkgwv
    

  • Chain '2':
    No sequence available.

  • Chain '3':
    Sequence, based on SEQRES records: (download)
    >6et53 (3:)
    mateyrtaswklwlildprrvltalfvyltviallihfgllstdrlnwwefqrglpkaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6et53 (3:)
    ateyrtaswklwlildprrvltalfvyltviallihfgllstdrlnwwefqrglpkaa
    

  • Chain '4':
    Sequence, based on SEQRES records: (download)
    >6et54 (4:)
    madlkpsltglteeeakefhgifvtstvlylatavivhylvwtarpwiapipkgwv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6et54 (4:)
    adlkpsltglteeeakefhgifvtstvlylatavivhylvwtarpwiapipkgwv
    

  • Chain '5':
    No sequence available.

  • Chain '6':
    Sequence, based on SEQRES records: (download)
    >6et56 (6:)
    mateyrtaswklwlildprrvltalfvyltviallihfgllstdrlnwwefqrglpkaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6et56 (6:)
    ateyrtaswklwlildprrvltalfvyltviallihfgllstdrlnwwefqrglpkaa
    

  • Chain '7':
    Sequence, based on SEQRES records: (download)
    >6et57 (7:)
    madlkpsltglteeeakefhgifvtstvlylatavivhylvwtarpwiapipkgwv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6et57 (7:)
    adlkpsltglteeeakefhgifvtstvlylatavivhylvwtarpwiapipkgwv
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6et5C (C:)
    cfepppatttqtgfrglsmgevlhpatvkakkerdaqyppalaavkaegppvsqvyknvk
    vlgnlteaeflrtmtaitewvspqegctychdennlaseakypyvvarrmlemtraintn
    wtqhvaqtgvtcytchrgtplppyvryleptlplnnretpthvervetrsgyvvrlakyt
    aysalnydpftmflandkrqvrvvpqtalplvgvsrgkerrplsdayatfalmmsisdsl
    gtnctfchnaqtfeswgkkstpqraiawwgirmvrdlnmnylaplnaslpasrlgrqgea
    pqadcrtchqgvtkplfgasrlkdypelgpika
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6et5G (G:)
    madlkpsltglteeeakefhgifvtstvlylatavivhylvwtarpwiapipkgwv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6et5G (G:)
    adlkpsltglteeeakefhgifvtstvlylatavivhylvwtarpwiapipkgwv
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6et5H (H:)
    myhgalaqhldiaqlvwyaqwlviwtvvllylrredrregyplveplglvklapedgqvy
    elpypktfvlphggtvtvprrrpetrelklaqtdgfegaplqptgnplvdavgpasyaer
    aevvdatvdgkakivplrvatdfsiaegdvdprglpvvaadgveagtvtdlwvdrsehyf
    rylelsvagsartaliplgfcdvkkdkivvtsilseqfanvprlqsrdqitlreedkvsa
    yyaggllyatperaesll
    

  • Chain 'I':
    No sequence available.

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >6et5K (K:)
    mateyrtaswklwlildprrvltalfvyltviallihfgllstdrlnwwefqrglpkaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6et5K (K:)
    ateyrtaswklwlildprrvltalfvyltviallihfgllstdrlnwwefqrglpkaa
    

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6et5M (M:)
    adyqtiytqiqargphitvsgewgdndrvgkpfysywlgkigdaqigpiylgasgiaafa
    fgstailiilfnmaaevhfdplqffrqffwlglyppkaqygmgipplhdggwwlmaglfm
    tlslgswwirvysraralglgthiawnfaaaiffvlcigcihptlvgswsegvpfgiwph
    idwltafsirygnfyycpwhgfsigfaygcgllfaahgatilavarfggdreieqitdrg
    taveraalfwrwtigfnatiesvhrwgwffslmvmvsasvgilltgtfvdnwylwcvkhg
    aapdypaylpatpdpaslpgapk
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >6et5N (N:)
    madlkpsltglteeeakefhgifvtstvlylatavivhylvwtarpwiapipkgwv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6et5N (N:)
    adlkpsltglteeeakefhgifvtstvlylatavivhylvwtarpwiapipkgwv
    

  • Chain 'O':
    No sequence available.

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >6et5P (P:)
    mateyrtaswklwlildprrvltalfvyltviallihfgllstdrlnwwefqrglpkaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6et5P (P:)
    ateyrtaswklwlildprrvltalfvyltviallihfgllstdrlnwwefqrglpkaa
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >6et5Q (Q:)
    madlkpsltglteeeakefhgifvtstvlylatavivhylvwtarpwiapipkgwv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6et5Q (Q:)
    adlkpsltglteeeakefhgifvtstvlylatavivhylvwtarpwiapipkgwv
    

  • Chain 'R':
    No sequence available.

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >6et5S (S:)
    mateyrtaswklwlildprrvltalfvyltviallihfgllstdrlnwwefqrglpkaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6et5S (S:)
    ateyrtaswklwlildprrvltalfvyltviallihfgllstdrlnwwefqrglpkaa
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >6et5T (T:)
    madlkpsltglteeeakefhgifvtstvlylatavivhylvwtarpwiapipkgwv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6et5T (T:)
    adlkpsltglteeeakefhgifvtstvlylatavivhylvwtarpwiapipkgwv
    

  • Chain 'U':
    No sequence available.

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >6et5V (V:)
    mateyrtaswklwlildprrvltalfvyltviallihfgllstdrlnwwefqrglpkaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6et5V (V:)
    ateyrtaswklwlildprrvltalfvyltviallihfgllstdrlnwwefqrglpkaa
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >6et5W (W:)
    madlkpsltglteeeakefhgifvtstvlylatavivhylvwtarpwiapipkgwv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6et5W (W:)
    adlkpsltglteeeakefhgifvtstvlylatavivhylvwtarpwiapipkgwv
    

  • Chain 'X':
    No sequence available.

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >6et5Y (Y:)
    mateyrtaswklwlildprrvltalfvyltviallihfgllstdrlnwwefqrglpkaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6et5Y (Y:)
    ateyrtaswklwlildprrvltalfvyltviallihfgllstdrlnwwefqrglpkaa
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >6et5Z (Z:)
    madlkpsltglteeeakefhgifvtstvlylatavivhylvwtarpwiapipkgwv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6et5Z (Z:)
    adlkpsltglteeeakefhgifvtstvlylatavivhylvwtarpwiapipkgwv
    

  • Chain 'a':
    No sequence available.

  • Chain 'b':
    Sequence, based on SEQRES records: (download)
    >6et5b (b:)
    mateyrtaswklwlildprrvltalfvyltviallihfgllstdrlnwwefqrglpkaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6et5b (b:)
    ateyrtaswklwlildprrvltalfvyltviallihfgllstdrlnwwefqrglpkaa
    

  • Chain 'c':
    No sequence available.

  • Chain 'd':
    No sequence available.

  • Chain 'e':
    Sequence, based on SEQRES records: (download)
    >6et5e (e:)
    mateyrtaswklwlildprrvltalfvyltviallihfgllstdrlnwwefqrglpkaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6et5e (e:)
    ateyrtaswklwlildprrvltalfvyltviallihfgllstdrlnwwefqrglpkaa
    

  • Chain 'f':
    Sequence, based on SEQRES records: (download)
    >6et5f (f:)
    madlkpsltglteeeakefhgifvtstvlylatavivhylvwtarpwiapipkgwv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6et5f (f:)
    adlkpsltglteeeakefhgifvtstvlylatavivhylvwtarpwiapipkgwv
    

  • Chain 'g':
    No sequence available.

  • Chain 'h':
    No sequence available.

  • Chain 'i':
    Sequence, based on SEQRES records: (download)
    >6et5i (i:)
    madlkpsltglteeeakefhgifvtstvlylatavivhylvwtarpwiapipkgwv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6et5i (i:)
    adlkpsltglteeeakefhgifvtstvlylatavivhylvwtarpwiapipkgwv
    

  • Chain 'j':
    No sequence available.

  • Chain 'k':
    No sequence available.

  • Chain 'l':
    Sequence, based on SEQRES records: (download)
    >6et5l (l:)
    madlkpsltglteeeakefhgifvtstvlylatavivhylvwtarpwiapipkgwv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6et5l (l:)
    adlkpsltglteeeakefhgifvtstvlylatavivhylvwtarpwiapipkgwv
    

  • Chain 'm':
    No sequence available.

  • Chain 'n':
    No sequence available.

  • Chain 'o':
    Sequence, based on SEQRES records: (download)
    >6et5o (o:)
    madlkpsltglteeeakefhgifvtstvlylatavivhylvwtarpwiapipkgwv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6et5o (o:)
    adlkpsltglteeeakefhgifvtstvlylatavivhylvwtarpwiapipkgwv
    

  • Chain 'p':
    No sequence available.

  • Chain 'q':
    No sequence available.

  • Chain 'r':
    Sequence, based on SEQRES records: (download)
    >6et5r (r:)
    madlkpsltglteeeakefhgifvtstvlylatavivhylvwtarpwiapipkgwv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6et5r (r:)
    adlkpsltglteeeakefhgifvtstvlylatavivhylvwtarpwiapipkgwv
    

  • Chain 's':
    No sequence available.

  • Chain 't':
    No sequence available.

  • Chain 'u':
    Sequence, based on SEQRES records: (download)
    >6et5u (u:)
    madlkpsltglteeeakefhgifvtstvlylatavivhylvwtarpwiapipkgwv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6et5u (u:)
    adlkpsltglteeeakefhgifvtstvlylatavivhylvwtarpwiapipkgwv
    

  • Chain 'v':
    No sequence available.

  • Chain 'w':
    No sequence available.

  • Chain 'x':
    Sequence, based on SEQRES records: (download)
    >6et5x (x:)
    madlkpsltglteeeakefhgifvtstvlylatavivhylvwtarpwiapipkgwv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6et5x (x:)
    adlkpsltglteeeakefhgifvtstvlylatavivhylvwtarpwiapipkgwv
    

  • Chain 'y':
    No sequence available.

  • Chain 'z':
    No sequence available.