PDB entry 6esu

View 6esu on RCSB PDB site
Description: Artificial imine reductase mutant S112A-N118P-K121A-S122M
Class: biotin-binding protein
Keywords: streptavidin, beta-barrel, biotin-binding protein
Deposited on 2017-10-24, released 2018-01-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-02-14, with a file datestamp of 2018-02-09.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22629 (13-End)
      • expression tag (12)
      • engineered mutation (111)
      • engineered mutation (117)
      • engineered mutation (120-121)
      • conflict (123)
    Domains in SCOPe 2.07: d6esua1, d6esua2
  • Heterogens: 6IR, IR, ACT, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6esuA (A:)
    masmtggqqmgrdeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgry
    dsapatdgsgtalgwtvawknnyrnahsattwsgqyvggaearintqwlltrgtteapaw
    amtyvghdtftkvkpsaasidaakkagvnngnpldavqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6esuA (A:)
    deagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
    lgwtvawknnyrnahsattwsgqyvggaearintqwlltrgtteapawamtyvghdtftk
    vkp