PDB entry 6esr

View 6esr on RCSB PDB site
Description: crystal structure of human iba57 at 1.75 a resolution
Deposited on 2017-10-24, released 2018-11-07
Made obsolete by 6qe3 on 2019-03-13

The last revision was dated 2019-03-13, with a file datestamp of 2019-03-08.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative transferase CAF17, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: IBA57, C1orf69
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6esrA (A:)
    aawacfrldgrtllrvrgpdaapfllglltnelplpspaaagappaaragyahflnvqgr
    tlydvilyglqehsevsgfllecdssvqgalqkhlalyrirrkvtvephpelrvwavlps
    speacgaaslqeragaaailirdprtarmgwrlltqdegpalvpggrlgdlwdyhqhryl
    qgvpegvrdlppgvalplesnlafmngvsftkgcyigqeltarthhmgvirkrlfpvrfl
    dplptsgitpgatvltasgqtvgkfragqgnvglallwsekikgplhirasegaqvalaa
    svpdwwpt