PDB entry 6esg

View 6esg on RCSB PDB site
Description: nucleosome breathing : class 2
Deposited on 2017-10-20, released 2017-12-20
The last revision was dated 2019-10-23, with a file datestamp of 2019-10-18.
Experiment type: EM
Resolution: 5.4 Å
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone H3.2
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P84233
      • variant (101)
  • Chain 'B':
    Compound: histone h4
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: histone h2a
    Species: Xenopus laevis [TaxId:8355]
    Gene: hist1h2aj, LOC494591
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Histone H2B 1.1
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Histone H3.2
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P84233
      • variant (101)
  • Chain 'F':
    Compound: histone h4
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: histone h2a
    Species: Xenopus laevis [TaxId:8355]
    Gene: hist1h2aj, LOC494591
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Histone H2B 1.1
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: DNA (141-mer)
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'J':
    Compound: DNA (141-mer)
    Species: synthetic construct, synthetic [TaxId:32630]

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6esgA (A:)
    artkqtarkstggkaprkqlatkaarksapatggvkkphryrpgtvalreirryqkstel
    lirklpfqrlvreiaqdfktdlrfqssavmalqeaseaylvalfedtnlcaihakrvtim
    pkdiqlarrirgera
    

    Sequence, based on observed residues (ATOM records):
    >6esgA (A:)
    phryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqease
    aylvalfedtnlcaihakrvtimpkdiqlarrirger
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6esgB (B:)
    sgrgkggkglgkggakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkv
    flenvirdavtytehakrktvtamdvvyalkrqgrtlygfgg
    

    Sequence, based on observed residues (ATOM records):
    >6esgB (B:)
    dniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvta
    mdvvyalkrqgrtlygfg
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >6esgC (C:)
    sgrgkqggktrakaktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleylta
    eilelagnaardnkktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpkkt
    essksaksk
    

    Sequence, based on observed residues (ATOM records):
    >6esgC (C:)
    trssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaardnkk
    triiprhlqlavrndeelnkllgrvtiaqggvlpniqsvl
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >6esgD (D:)
    aksapapkkgskkavtktqkkdgkkrrktrkesyaiyvykvlkqvhpdtgisskamsimn
    sfvndvferiageasrlahynkrstitsreiqtavrlllpgelakhavsegtkavtkyts
    ak
    

    Sequence, based on observed residues (ATOM records):
    >6esgD (D:)
    syaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkrstitsreiq
    tavrlllpgelakhavsegtkavtkytsa
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >6esgE (E:)
    artkqtarkstggkaprkqlatkaarksapatggvkkphryrpgtvalreirryqkstel
    lirklpfqrlvreiaqdfktdlrfqssavmalqeaseaylvalfedtnlcaihakrvtim
    pkdiqlarrirgera
    

    Sequence, based on observed residues (ATOM records):
    >6esgE (E:)
    rpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeaseaylv
    alfedtnlcaihakrvtimpkdiqlarrirge
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >6esgF (F:)
    sgrgkggkglgkggakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkv
    flenvirdavtytehakrktvtamdvvyalkrqgrtlygfgg
    

    Sequence, based on observed residues (ATOM records):
    >6esgF (F:)
    dniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvta
    mdvvyalkrqgrtlygfg
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >6esgG (G:)
    sgrgkqggktrakaktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleylta
    eilelagnaardnkktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpkkt
    essksaksk
    

    Sequence, based on observed residues (ATOM records):
    >6esgG (G:)
    trssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaardnkk
    triiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllp
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >6esgH (H:)
    aksapapkkgskkavtktqkkdgkkrrktrkesyaiyvykvlkqvhpdtgisskamsimn
    sfvndvferiageasrlahynkrstitsreiqtavrlllpgelakhavsegtkavtkyts
    ak
    

    Sequence, based on observed residues (ATOM records):
    >6esgH (H:)
    syaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkrstitsreiq
    tavrlllpgelakhavsegtkavtkytsa
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.