PDB entry 6es8

View 6es8 on RCSB PDB site
Description: HIV capsid hexamer with IP6 ligand
Class: viral protein
Keywords: hiv, viral protein
Deposited on 2017-10-19, released 2018-08-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-15, with a file datestamp of 2018-08-10.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gag protein
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot B9V8I5 (0-218)
      • conflict (13)
      • conflict (44)
      • conflict (74)
      • conflict (207)
    Domains in SCOPe 2.07: d6es8a1, d6es8a2
  • Heterogens: IHP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6es8A (A:)
    pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpgatleemmtacq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6es8A (A:)
    pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhiapgqmreprgsdiagttstlqeqigwmthnpp
    ipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqtllvqna
    npdcktilkalgpgatleemmtacq