PDB entry 6es7

View 6es7 on RCSB PDB site
Description: Structure and dynamics conspire in the evolution of affinity between intrinsically disordered proteins
Class: DNA binding protein
Keywords: complex, IDP, CID, NCBD, DNA BINDING PROTEIN
Deposited on 2017-10-19, released 2018-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-31, with a file datestamp of 2018-10-26.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nuclear receptor coactivator 3
    Species: Homo sapiens [TaxId:9606]
    Gene: NCOA3, AIB1, BHLHE42, RAC3, TRAM1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y6Q9 (2-43)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d6es7a1, d6es7a2
  • Chain 'B':
    Compound: creb-binding protein
    Species: Homo sapiens [TaxId:9606]
    Gene: CREBBP, CBP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92793 (1-49)
      • expression tag (0)
    Domains in SCOPe 2.07: d6es7b1, d6es7b2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6es7A (A:)
    gsegqsderalldqlhtllsntdatgleeidralgipelvnqgq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6es7B (B:)
    gsispsalqdllrtlkspsspqqqqqvlnilksnpqlmaafikqrtakyv