PDB entry 6es5

View 6es5 on RCSB PDB site
Description: structure and dynamics conspire in the evolution of affinity between intrinsically disordered proteins
Deposited on 2017-10-19, released 2018-10-31
The last revision was dated 2019-05-15, with a file datestamp of 2019-05-10.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cid
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6ES5 (0-44)
  • Chain 'B':
    Compound: ncbd
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6ES5 (0-49)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6es5A (A:)
gsesqndekalldqldsllsstdemelaeidralgidklvsqqgg

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >6es5B (B:)
gstppqalqqllqtlkspsspqqqqqvlqilksnpqlmaafikqrsqhqq