PDB entry 6es3

View 6es3 on RCSB PDB site
Description: structure of cdx2-dna(tcg)
Deposited on 2017-10-19, released 2018-03-21
The last revision was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: XRAY
Resolution: 2.57 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: DNA (5'-d(p*tp*tp*gp*tp*gp*tp*tp*tp*tp*ap*cp*gp*ap*cp*cp*tp*cp*c)-3')
  Species: HOMO SAPIENS, synthetic [TaxId:9606]
  
• Chain 'B':
  Compound: DNA (5'-d(p*tp*tp*gp*tp*gp*tp*tp*tp*tp*ap*cp*gp*ap*cp*cp*tp*cp*c)-3')
  Species: HOMO SAPIENS, synthetic [TaxId:9606]
  
• Chain 'E':
  Compound: DNA (5'-d(p*gp*gp*ap*gp*gp*tp*cp*gp*tp*ap*ap*ap*ap*cp*ap*cp*ap*a)-3')
  Species: HOMO SAPIENS, synthetic [TaxId:9606]
  
• Chain 'F':
  Compound: DNA (5'-d(p*gp*gp*ap*gp*gp*tp*cp*gp*tp*ap*ap*ap*ap*cp*ap*cp*ap*a)-3')
  Species: HOMO SAPIENS, synthetic [TaxId:9606]
  
• Chain 'K':
  Compound: Homeobox protein CDX-2
  Species: Homo sapiens [TaxId:9606]
  Gene: CDX2, CDX3
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q99626 (0-71)
• Chain 'M':
  Compound: Homeobox protein CDX-2
  Species: Homo sapiens [TaxId:9606]
  Gene: CDX2, CDX3
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q99626 (0-71)
• Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  No sequence available.
  
  
• Chain 'K':
  Sequence; same for both SEQRES and ATOM records:
  

  >6es3K (K:)
  rtkdkyrvvytdhqrlelekefhysryitirrkaelaatlglserqvkiwfqnrrakerk
  inkkklqqqqqq
  

  
  
• Chain 'M':
  Sequence; same for both SEQRES and ATOM records:
  

  >6es3M (M:)
  rtkdkyrvvytdhqrlelekefhysryitirrkaelaatlglserqvkiwfqnrrakerk
  inkkklqqqqqq