PDB entry 6es2

View 6es2 on RCSB PDB site
Description: structure of cdx2-dna(caa)
Deposited on 2017-10-19, released 2018-03-21
The last revision was dated 2018-05-16, with a file datestamp of 2018-05-11.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: DNA (5'-d(p*tp*tp*gp*tp*gp*tp*tp*tp*tp*ap*tp*tp*gp*cp*cp*tp*cp*c)-3')
  Species: HOMO SAPIENS, synthetic [TaxId:9606]
  
• Chain 'B':
  Compound: DNA (5'-d(p*tp*tp*gp*tp*gp*tp*tp*tp*tp*ap*tp*tp*gp*cp*cp*tp*cp*c)-3')
  Species: HOMO SAPIENS, synthetic [TaxId:9606]
  
• Chain 'D':
  Compound: DNA (5'-d(p*gp*gp*ap*gp*gp*cp*ap*ap*tp*ap*ap*ap*ap*cp*ap*cp*ap*a)-3')
  Species: HOMO SAPIENS, synthetic [TaxId:9606]
  
• Chain 'E':
  Compound: DNA (5'-d(p*gp*gp*ap*gp*gp*cp*ap*ap*tp*ap*ap*ap*ap*cp*ap*cp*ap*a)-3')
  Species: HOMO SAPIENS, synthetic [TaxId:9606]
  
• Chain 'K':
  Compound: Homeobox protein CDX-2
  Species: Homo sapiens [TaxId:9606]
  Gene: CDX2, CDX3
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q99626 (Start-70)
• Chain 'L':
  Compound: Homeobox protein CDX-2
  Species: Homo sapiens [TaxId:9606]
  Gene: CDX2, CDX3
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q99626 (0-End)
• Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'K':
  Sequence, based on SEQRES records:
  

  >6es2K (K:)
  kdkyrvvytdhqrlelekefhysryitirrkaelaatlglserqvkiwfqnrrakerkin
  kkklqqqqqqq
  

  
  Sequence, based on observed residues (ATOM records):
  

  >6es2K (K:)
  dkyrvvytdhqrlelekefhysryitirrkaelaatlglserqvkiwfqnrrakerkink
  kklqqqqqqq
  

  
  
• Chain 'L':
  Sequence, based on SEQRES records:
  

  >6es2L (L:)
  kdkyrvvytdhqrlelekefhysryitirrkaelaatlglserqvkiwfqnrrakerkin
  kkklqqqqqqq
  

  
  Sequence, based on observed residues (ATOM records):
  

  >6es2L (L:)
  kdkyrvvytdhqrlelekefhysryitirrkaelaatlglserqvkiwfqnrrakerkin
  kkklqqqqqq