PDB entry 6es1

View 6es1 on RCSB PDB site
Description: Crystal structure of the binding domain from botulinum neurotoxin A2 bound to extracellular domain of human receptor SV2C
Class: protein binding
Keywords: Receptor, Human, Clostridium botulinum, Binding domain, SV2C, PROTEIN BINDING
Deposited on 2017-10-19, released 2018-04-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-25, with a file datestamp of 2018-04-20.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Botulinum neurotoxin type A
    Species: Clostridium botulinum [TaxId:1491]
    Gene: botA, atx, bna
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6es1a1, d6es1a2
  • Chain 'B':
    Compound: Synaptic vesicle glycoprotein 2C
    Species: Homo sapiens [TaxId:9606]
    Gene: SV2C, KIAA1054
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q496J9 (23-116)
      • expression tag (22)
  • Heterogens: ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6es1A (A:)
    mgsshhhhhhssgenlyfqghmvntsilsivykkddlidlsrygakinigdrvyydsidk
    nqiklinlesstievilknaivynsmyenfstsfwikipkyfskinlnneytiincienn
    sgwkvslnygeiiwtlqdnkqniqrvvfkysqmvnisdyinrwifvtitnnrltkskiyi
    ngrlidqkpisnlgnihasnkimfkldgcrdprryimikyfnlfdkelnekeikdlydsq
    snsgilkdfwgnylqydkpyymlnlfdpnkyvdvnnigirgymylkgprgsvvttniyln
    stlyegtkfiikkyasgnednivrnndrvyinvvvknkeyrlatnasqagvekilsalei
    pdvgnlsqvvvmkskddqgirnkckmnlqdnngndigfigfhlydniaklvasnwynrqv
    gkasrtfgcswefipvddgwgessl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6es1A (A:)
    tsilsivykkddlidlsrygakinigdrvyydsidknqiklinlesstievilknaivyn
    smyenfstsfwikipkyfskinlnneytiinciennsgwkvslnygeiiwtlqdnkqniq
    rvvfkysqmvnisdyinrwifvtitnnrltkskiyingrlidqkpisnlgnihasnkimf
    kldgcrdprryimikyfnlfdkelnekeikdlydsqsnsgilkdfwgnylqydkpyymln
    lfdpnkyvdvnnigirgymylkgprgsvvttniylnstlyegtkfiikkyasgnednivr
    nndrvyinvvvknkeyrlatnasqagvekilsaleipdvgnlsqvvvmkskddqgirnkc
    kmnlqdnngndigfigfhlydniaklvasnwynrqvgkasrtfgcswefipvddgwgess
    

  • Chain 'B':
    No sequence available.