PDB entry 6ery

View 6ery on RCSB PDB site
Description: The crystal structure of mouse chloride intracellular channel protein 6
Class: transport protein
Keywords: CLIC, GST, Glutathione Transferase, Ion channel, CHLORIDE CHANNEL, TRANSPORT PROTEIN
Deposited on 2017-10-19, released 2018-05-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-05-16, with a file datestamp of 2018-05-11.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chloride intracellular channel protein 6
    Species: Mus musculus [TaxId:10090]
    Gene: Clic6
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8BHB9 (4-End)
      • expression tag (2-3)
    Domains in SCOPe 2.08: d6erya1, d6erya2, d6erya3
  • Chain 'B':
    Compound: Chloride intracellular channel protein 6
    Species: Mus musculus [TaxId:10090]
    Gene: Clic6
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8BHB9 (4-237)
      • expression tag (0-3)
    Domains in SCOPe 2.08: d6eryb1, d6eryb2, d6eryb3
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6eryA (A:)
    gamgitlfvkagydgesigncpfsqrlfmilwlkgvifnvttvdlkrkpadlqnlapgtn
    ppfmtfdgevktdvnkieefleeklvpprypklgtqhpesnsagndvfakfsafikntkk
    daneiyeknllralkkldsylnsplpdeidadssedvtvsqrkfldgdeltladcnllpk
    lhiikivakkyrdfefpsemtgiwrylnnayardeftntcpadreiehaysdaakrmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6eryA (A:)
    mgitlfvkagydgesigncpfsqrlfmilwlkgvifnvttvdlkrkpadlqnlapgtnpp
    fmtfdgevktdvnkieefleeklvpprypklgtqhpesnsagndvfakfsafikntkkda
    neiyeknllralkkldsylnsplpdeidadssedvtvsqrkfldgdeltladcnllpklh
    iikivakkyrdfefpsemtgiwrylnnayardeftntcpadreiehaysdaakr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6eryB (B:)
    gamgitlfvkagydgesigncpfsqrlfmilwlkgvifnvttvdlkrkpadlqnlapgtn
    ppfmtfdgevktdvnkieefleeklvpprypklgtqhpesnsagndvfakfsafikntkk
    daneiyeknllralkkldsylnsplpdeidadssedvtvsqrkfldgdeltladcnllpk
    lhiikivakkyrdfefpsemtgiwrylnnayardeftntcpadreiehaysdaakrmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6eryB (B:)
    gamgitlfvkagydgesigncpfsqrlfmilwlkgvifnvttvdlnlapgtnppfmtfdg
    evktdvnkieefleeklvpprypklgtqhpesnsagndvfakfsafikntkkdaneiyek
    nllralkkldsylnsplpdeidadssedvtvsqrkfldgdeltladcnllpklhiikiva
    kkyrdfefpsemtgiwrylnnayardeftntcpadreiehaysdaakrmk