PDB entry 6erm

View 6erm on RCSB PDB site
Description: HIV Hexamer with ligand
Class: viral protein
Keywords: hiv, viral protein
Deposited on 2017-10-18, released 2018-11-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-07, with a file datestamp of 2018-11-02.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gag polyprotein
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot B6DRA0 (0-218)
      • conflict (13)
      • conflict (44)
    Domains in SCOPe 2.07: d6erma1, d6erma2
  • Heterogens: AZT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ermA (A:)
    pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpgatleemmtacq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ermA (A:)
    pivqnqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvgghq
    aamqmlketineeaaewdrlhpvhiapgqmreprgsdiagttstlqeqigwmthnppipv
    geiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqtllvqnanpd
    cktilkalgpgatleemmtacq