PDB entry 6erj

View 6erj on RCSB PDB site
Description: Self-complemented FimA subunit from Salmonella enterica
Class: structural protein
Keywords: FimA, subunit, pilus, pili, tyle-1 pilus, type-1 pili, salmonella, enterica, structural protein, immunoglobulin-like, fold, self-complemented
Deposited on 2017-10-18, released 2019-01-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-30, with a file datestamp of 2019-01-25.
Experiment type: XRAY
Resolution: 1.69 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Type-1 fimbrial protein, A chain
    Species: Salmonella paratyphi A (strain ATCC 9150 / SARB42) [TaxId:295319]
    Gene: fimA, SPA2182
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6erja_
  • Chain 'B':
    Compound: Type-1 fimbrial protein, A chain
    Species: Salmonella paratyphi A (strain ATCC 9150 / SARB42) [TaxId:295319]
    Gene: fimA, SPA2182
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6erjb_
  • Heterogens: ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6erjA (A:)
    mdptpvsvsggtihfegklvnaacavstksadqtvtlgqyrtasftaigdttaqvpfsiv
    lndcdpkvaataavafsgqadntntnllavssadnsttatgvgieildntssplkpdgat
    fsakqalvegtntlrftarykataaattpgqanadatfimkye
    

    Sequence, based on observed residues (ATOM records): (download)
    >6erjA (A:)
    dptpvsvsggtihfegklvnaacavstksadqtvtlgqyrtasftaigdttaqvpfsivl
    ndcdpkvaataavafsgqadntntnllavssadsttatgvgieildntssplkpdgatfs
    akqalvegtntlrftarykataaattpgqanadatfimkye
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6erjB (B:)
    madptpvsvsggtihfegklvnaacavstksadqtvtlgqyrtasftaigdttaqvpfsi
    vlndcdpkvaataavafsgqadntntnllavssadnsttatgvgieildntssplkpdga
    tfsakqalvegtntlrftarykataaattpgqanadatfimkye
    

    Sequence, based on observed residues (ATOM records): (download)
    >6erjB (B:)
    tpvsvsggtihfegklvnaacavstksadqtvtlgqyrtasftaigdttaqvpfsivlnd
    cdpkvaataavafsgqadntntnllavssadnsttatgvgieildntssplkpdgatfsa
    kqalvegtntlrftarykataaattpgqanadatfimkye