PDB entry 6erg

View 6erg on RCSB PDB site
Description: complex of xlf and heterodimer ku bound to dna
Deposited on 2017-10-18, released 2018-10-17
The last revision was dated 2019-04-03, with a file datestamp of 2019-03-29.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: X-ray repair cross-complementing protein 6
    Species: Homo sapiens [TaxId:9606]
    Gene: XRCC6, G22P1
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: X-ray repair cross-complementing protein 5
    Species: Homo sapiens [TaxId:9606]
    Gene: XRCC5, G22P2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13010 (18-End)
      • initiating methionine (0)
      • expression tag (1-17)
  • Chain 'C':
    Compound: Non-homologous end-joining factor 1
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: X-ray repair cross-complementing protein 6
    Species: Homo sapiens [TaxId:9606]
    Gene: XRCC6, G22P1
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: X-ray repair cross-complementing protein 5
    Species: Homo sapiens [TaxId:9606]
    Gene: XRCC5, G22P2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13010 (18-End)
      • initiating methionine (0)
      • expression tag (1-17)
  • Chain 'F':
    Compound: Non-homologous end-joining factor 1
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: DNA (21-mer)
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'K':
    Compound: DNA (21-mer)
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'M':
    Compound: DNA (34-mer)
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'R':
    Compound: DNA (34-mer)
    Species: synthetic construct, synthetic [TaxId:32630]
  • Heterogens: SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6ergA (A:)
    msgwesyyktegdeeaeeeqeenleasgdykysgrdsliflvdaskamfesqsedeltpf
    dmsiqciqsvyiskiissdrdllavvfygtekdknsvnfkniyvlqeldnpgakrileld
    qfkgqqgqkrfqdmmghgsdyslsevlwvcanlfsdvqfkmshkrimlftnednphgnds
    akasrartkagdlrdtgifldlmhlkkpggfdislfyrdiisiaededlrvhfeesskle
    dllrkvraketrkralsrlklklnkdivisvgiynlvqkalkpppiklyretnepvktkt
    rtfntstgglllpsdtkrsqiygsrqiilekeeteelkrfddpglmlmgfkplvllkkhh
    ylrpslfvypeeslvigsstlfsallikclekevaalcrytprrnippyfvalvpqeeel
    ddqkiqvtppgfqlvflpfaddkrkmpftekimatpeqvgkmkaiveklrftyrsdsfen
    pvlqqhfrnlealaldlmepeqavdltlpkveamnkrlgslvdefkelvyppdynpegkv
    tkrk
    

    Sequence, based on observed residues (ATOM records):
    >6ergA (A:)
    grdsliflvdaskamfesqsedeltpfdmsiqciqsvyiskiissdrdllavvfygtekd
    knsvnfkniyvlqeldnpgakrileldqfkgqqgqkrfqdmmghgsdyslsevlwvcanl
    fsdvqfkmshkrimlftnednphgndsakasrartkagdlrdtgifldlmhlkkpggfdi
    slfyrdiisiaededlrvhfeesskledllrkvraketrkralsrlklklnkdivisvgi
    ynlvqkalkpppiklyretnepvktktrtfntstgglllpsdtkrsqiygsrqiilekee
    teelkrfddpglmlmgfkplvllkkhhylrpslfvypeeslvigsstlfsallikcleke
    vaalcrytprrnippyfvalvpqeeelddqkiqvtppgfqlvflpfaddkrkmpftekim
    atpeqvgkmkaiveklrftyrsdsfenpvlqqhfrnlealaldlmepeqavdltlpkvea
    mnkrlgslvdefkelvyppdy
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6ergB (B:)
    mhhhhhhhhhhenlyfqgvrsgnkaavvlcmdvgftmsnsipgiespfeqakkvitmfvq
    rqvfaenkdeialvlfgtdgtdnplsggdqyqnitvhrhlmlpdfdlledieskiqpgsq
    qadfldalivsmdviqhetigkkfekrhieiftdlssrfsksqldiiihslkkcdislqf
    flpfslgkedgsgdrgdgpfrlgghgpsfplkgiteqqkegleivkmvmislegedglde
    iysfseslrklcvfkkierhsihwpcrltigsnlsiriaayksilqervkktwtvvdakt
    lkkediqketvyclndddetevlkediiqgfrygsdivpfskvdeeqmkyksegkcfsvl
    gfckssqvqrrffmgnqvlkvfaarddeaaavalsslihalddldmvaivryaydkranp
    qvgvafphikhnyeclvyvqlpfmedlrqymfsslknskkyapteaqlnavdalidsmsl
    akkdektdtledlfpttkipnprfqrlfqcllhralhpreplppiqqhiwnmlnppaevt
    tksqiplskiktlfplieakkkdqvtaqeifq
    

    Sequence, based on observed residues (ATOM records):
    >6ergB (B:)
    mhhhhhhhhhhenlyfqgvrsgnkaavvlcmdvgftmsnsipgiespfeqakkvitmfvq
    rqvfaenkdeialvlfgtdgtdnplsggdqyqnitvhrhlmlpdfdlledieskiqpgsq
    qadfldalivsmdviqhetigkkfekrhieiftdlssrfsksqldiiihslkkcdislqf
    flpfslgkgiteqqkegleivkmvmislegedgldeiysfseslrklcvfkkierhsihw
    pcrltigsnlsiriaayksilqervkktwtvvdaktlkkediqketvycletevlkedii
    qgfrygsdivpfskvdeeqmkyksegkcfsvlgfckssqvqrrffmgnqvlkvfaardde
    aaavalsslihalddldmvaivryaydkranpqvgvafphikhnyeclvyvqlpfmedlr
    qymfsslknskkyapteaqlnavdalidsmslakkdektdtledlfpttkipnprfqrlf
    qcllhralhpreplppiqqhiwnmlnppaevttksqiplskiktlfpliea
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >6ergC (C:)
    skvkrkkprglfs
    

    Sequence, based on observed residues (ATOM records):
    >6ergC (C:)
    kprglfs
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >6ergD (D:)
    msgwesyyktegdeeaeeeqeenleasgdykysgrdsliflvdaskamfesqsedeltpf
    dmsiqciqsvyiskiissdrdllavvfygtekdknsvnfkniyvlqeldnpgakrileld
    qfkgqqgqkrfqdmmghgsdyslsevlwvcanlfsdvqfkmshkrimlftnednphgnds
    akasrartkagdlrdtgifldlmhlkkpggfdislfyrdiisiaededlrvhfeesskle
    dllrkvraketrkralsrlklklnkdivisvgiynlvqkalkpppiklyretnepvktkt
    rtfntstgglllpsdtkrsqiygsrqiilekeeteelkrfddpglmlmgfkplvllkkhh
    ylrpslfvypeeslvigsstlfsallikclekevaalcrytprrnippyfvalvpqeeel
    ddqkiqvtppgfqlvflpfaddkrkmpftekimatpeqvgkmkaiveklrftyrsdsfen
    pvlqqhfrnlealaldlmepeqavdltlpkveamnkrlgslvdefkelvyppdynpegkv
    tkrk
    

    Sequence, based on observed residues (ATOM records):
    >6ergD (D:)
    ysgrdsliflvdaskamfesqsedeltpfdmsiqciqsvyiskiissdrdllavvfygte
    kdknsvnfkniyvlqeldnpgakrileldqfkgqqgqkrfqdmmghgsdyslsevlwvca
    nlfsdvqfkmshkrimlftnednphgndsakasrartkagdlrdtgifldlmhlkkpggf
    dislfyrdiisiaededlrvhfeesskledllrkvraketrkralsrlklklnkdivisv
    giynlvqkalkpppiklyretnepvktktrtfntstgglllpsdtkrsqiygsrqiilek
    eeteelkrfddpglmlmgfkplvllkkhhylrpslfvypeeslvigsstlfsallikcle
    kevaalcrytprrnippyfvalvpqeeelddqkiqvtppgfqlvflpfaddkrkmpftek
    imatpeqvgkmkaiveklrftyrsdsfenpvlqqhfrnlealaldlmepeqavdltlpkv
    eamnkrlgslvdefkelvyppdy
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >6ergE (E:)
    mhhhhhhhhhhenlyfqgvrsgnkaavvlcmdvgftmsnsipgiespfeqakkvitmfvq
    rqvfaenkdeialvlfgtdgtdnplsggdqyqnitvhrhlmlpdfdlledieskiqpgsq
    qadfldalivsmdviqhetigkkfekrhieiftdlssrfsksqldiiihslkkcdislqf
    flpfslgkedgsgdrgdgpfrlgghgpsfplkgiteqqkegleivkmvmislegedglde
    iysfseslrklcvfkkierhsihwpcrltigsnlsiriaayksilqervkktwtvvdakt
    lkkediqketvyclndddetevlkediiqgfrygsdivpfskvdeeqmkyksegkcfsvl
    gfckssqvqrrffmgnqvlkvfaarddeaaavalsslihalddldmvaivryaydkranp
    qvgvafphikhnyeclvyvqlpfmedlrqymfsslknskkyapteaqlnavdalidsmsl
    akkdektdtledlfpttkipnprfqrlfqcllhralhpreplppiqqhiwnmlnppaevt
    tksqiplskiktlfplieakkkdqvtaqeifq
    

    Sequence, based on observed residues (ATOM records):
    >6ergE (E:)
    mhhhhhhhhhhenlyfqgvrsgnkaavvlcmdvgftmsnsipgiespfeqakkvitmfvq
    rqvfaenkdeialvlfgtdgtdnplsggdqyqnitvhrhlmlpdfdlledieskiqpgsq
    qadfldalivsmdviqhetigkkfekrhieiftdlssrfsksqldiiihslkkcdislqf
    flpfslgkgiteqqkegleivkmvmislegedgldeiysfseslrklcvfkkierhsihw
    pcrltigsnlsiriaayksilqervkktwtvvdaktlkkediqketvyclndddetevlk
    ediiqgfrygsdivpfskvdeeqmkyksegkcfsvlgfckssqvqrrffmgnqvlkvfaa
    rddeaaavalsslihalddldmvaivryaydkranpqvgvafphikhnyeclvyvqlpfm
    edlrqymfsslknskkyapteaqlnavdalidsmslakkdektdtledlfpttkipnprf
    qrlfqcllhralhpreplppiqqhiwnmlnppaevttksqiplskiktlfplieak
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >6ergF (F:)
    skvkrkkprglfs
    

    Sequence, based on observed residues (ATOM records):
    >6ergF (F:)
    kprglfs
    

  • Chain 'H':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'M':
    No sequence available.

  • Chain 'R':
    No sequence available.