PDB entry 6eqj

View 6eqj on RCSB PDB site
Description: Crystal Structure of Human Glycogenin-1 (GYG1) Tyr195pIPhe mutant, apo form
Class: hydrolase
Keywords: glycogenin-1, hydrolase
Deposited on 2017-10-13, released 2017-12-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-11-14, with a file datestamp of 2018-11-09.
Experiment type: XRAY
Resolution: 2.18 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glycogenin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: GYG1, GYG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6eqja_
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6eqjA (A:)
    smtdqafvtlttndayakgalvlgsslkqhrttrrlvvlatpqvsdsmrkvletvfdevi
    mvdvldsgdsahltlmkrpelgvtltklhcwsltqyskcvfmdadtlvlaniddlfdree
    lsaapdpgwpdcfnsgvfvyqpsvetynqllhlaseqgsfdggdqgilntffsswattdi
    rkhlpfiynlssisifsylpafkvfgasakvvhflgrvkpwnytydpktksvkseahdpn
    mthpeflilwwnifttnvlpllq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6eqjA (A:)
    mtdqafvtlttndayakgalvlgsslkqhrttrrlvvlatpqvsdsmrkvletvfdevim
    vdvldsgdsahltlmkrpelgvtltklhcwsltqyskcvfmdadtlvlaniddlfdreel
    saapdpgwpdcfnsgvfvyqpsvetynqllhlaseqgsfdggdqgilntffsswattdir
    khlpfiynlssilpafkvfgasakvvhflgrvkpwnytydpktksvkpeflilwwniftt
    nvlpl