PDB entry 6eqi

View 6eqi on RCSB PDB site
Description: Structure of PINK1 bound to ubiquitin
Class: transferase
Keywords: PINK1 Ubiquitin Mitophagy Nanobody Substrate recognition Complex Parkinson's disease, TRANSFERASE
Deposited on 2017-10-13, released 2017-11-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-20, with a file datestamp of 2017-12-15.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin
    Species: Homo sapiens [TaxId:9606]
    Gene: UBC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0CG48 (0-End)
      • engineered mutation (65-66)
    Domains in SCOPe 2.07: d6eqia_
  • Chain 'B':
    Compound: Nb696
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 6EQI (0-End)
    Domains in SCOPe 2.07: d6eqib_
  • Chain 'C':
    Compound: Serine/threonine-protein kinase PINK1, putative
    Species: Pediculus humanus corporis [TaxId:121224]
    Gene: 8239562, Phum_PHUM577390
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6eqiA (A:)
    mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkesvnhlvlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6eqiA (A:)
    mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkesvnhlvlrl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6eqiB (B:)
    qvqlvesggglvqaggslklscttsgrpfstfdlawfrqapgkerefvsglrrggstfya
    dsvsgrftisggstkntlylqmnslkpedtaiyycarsitgyglvdsashytiwgqgtqv
    tvsshhhhhhepea
    

    Sequence, based on observed residues (ATOM records): (download)
    >6eqiB (B:)
    qvqlvesggglvqaggslklscttsgrpfstfdlawfrqapgkerefvsglrrggstfya
    dsvsgrftisgtkntlylqmnslkpedtaiyycarsitgyglvdsashytiwgqgtqvtv
    sshh
    

  • Chain 'C':
    No sequence available.