PDB entry 6eqh

View 6eqh on RCSB PDB site
Description: Crystal structure of a polyethylene terephthalate degrading hydrolase from Ideonella sakaiensis in spacegroup C2221
Class: hydrolase
Keywords: PETase, PET degradation, a/b hydrolase, HYDROLASE
Deposited on 2017-10-12, released 2018-04-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-25, with a file datestamp of 2018-04-20.
Experiment type: XRAY
Resolution: 1.58 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Poly(ethylene terephthalate) hydrolase
    Species: Ideonella sakaiensis (strain 201-F6) [TaxId:1547922]
    Gene: ISF6_4831
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0K8P6T7 (Start-289)
      • expression tag (290)
    Domains in SCOPe 2.07: d6eqha1, d6eqha2
  • Chain 'B':
    Compound: Poly(ethylene terephthalate) hydrolase
    Species: Ideonella sakaiensis (strain 201-F6) [TaxId:1547922]
    Gene: ISF6_4831
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0K8P6T7 (Start-289)
      • expression tag (290-291)
    Domains in SCOPe 2.07: d6eqhb1, d6eqhb2
  • Chain 'C':
    Compound: Poly(ethylene terephthalate) hydrolase
    Species: Ideonella sakaiensis (strain 201-F6) [TaxId:1547922]
    Gene: ISF6_4831
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6eqhc_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6eqhA (A:)
    mnfprasrlmqaavlgglmavsaaataqtnpyargpnptaasleasagpftvrsftvsrp
    sgygagtvyyptnaggtvgaiaivpgytarqssikwwgprlashgfvvitidtnstldqp
    ssrssqqmaalrqvaslngtssspiygkvdtarmgvmgwsmggggslisaannpslkaaa
    pqapwdsstnfssvtvptlifacendsiapvnssalpiydsmsrnakqfleinggshsca
    nsgnsnqaligkkgvawmkrfmdndtrystfacenpnstrvsdfrtancslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6eqhA (A:)
    tnpyargpnptaasleasagpftvrsftvsrpsgygagtvyyptnaggtvgaiaivpgyt
    arqssikwwgprlashgfvvitidtnstldqpssrssqqmaalrqvaslngtssspiygk
    vdtarmgvmgwsmggggslisaannpslkaaapqapwdsstnfssvtvptlifacendsi
    apvnssalpiydsmsrnakqfleinggshscansgnsnqaligkkgvawmkrfmdndtry
    stfacenpnstrvsdfrtancsl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6eqhB (B:)
    mnfprasrlmqaavlgglmavsaaataqtnpyargpnptaasleasagpftvrsftvsrp
    sgygagtvyyptnaggtvgaiaivpgytarqssikwwgprlashgfvvitidtnstldqp
    ssrssqqmaalrqvaslngtssspiygkvdtarmgvmgwsmggggslisaannpslkaaa
    pqapwdsstnfssvtvptlifacendsiapvnssalpiydsmsrnakqfleinggshsca
    nsgnsnqaligkkgvawmkrfmdndtrystfacenpnstrvsdfrtancslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6eqhB (B:)
    tnpyargpnptaasleasagpftvrsftvsrpsgygagtvyyptnaggtvgaiaivpgyt
    arqssikwwgprlashgfvvitidtnstldqpssrssqqmaalrqvaslngtssspiygk
    vdtarmgvmgwsmggggslisaannpslkaaapqapwdsstnfssvtvptlifacendsi
    apvnssalpiydsmsrnakqfleinggshscansgnsnqaligkkgvawmkrfmdndtry
    stfacenpnstrvsdfrtancsle
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6eqhC (C:)
    mnfprasrlmqaavlgglmavsaaataqtnpyargpnptaasleasagpftvrsftvsrp
    sgygagtvyyptnaggtvgaiaivpgytarqssikwwgprlashgfvvitidtnstldqp
    ssrssqqmaalrqvaslngtssspiygkvdtarmgvmgwsmggggslisaannpslkaaa
    pqapwdsstnfssvtvptlifacendsiapvnssalpiydsmsrnakqfleinggshsca
    nsgnsnqaligkkgvawmkrfmdndtrystfacenpnstrvsdfrtancslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6eqhC (C:)
    tnpyargpnptaasleasagpftvrsftvsrpsgygagtvyyptnaggtvgaiaivpgyt
    arqssikwwgprlashgfvvitidtnstldqpssrssqqmaalrqvaslngtssspiygk
    vdtarmgvmgwsmggggslisaannpslkaaapqapwdsstnfssvtvptlifacendsi
    apvnssalpiydsmsrnakqfleinggshscansgnsnqaligkkgvawmkrfmdndtry
    stfacenpnstrvsdfrtancs