PDB entry 6eqe

View 6eqe on RCSB PDB site
Description: High resolution crystal structure of a polyethylene terephthalate degrading hydrolase from Ideonella sakaiensis
Class: hydrolase
Keywords: PETase, PET degradation, a/b hydrolase, HYDROLASE
Deposited on 2017-10-12, released 2018-04-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-25, with a file datestamp of 2018-04-20.
Experiment type: XRAY
Resolution: 0.92 Å
R-factor: N/A
AEROSPACI score: 0.9 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Poly(ethylene terephthalate) hydrolase
    Species: Ideonella sakaiensis (strain 201-F6) [TaxId:1547922]
    Gene: ISF6_4831
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0K8P6T7 (Start-289)
      • expression tag (290-292)
    Domains in SCOPe 2.07: d6eqea1, d6eqea2
  • Heterogens: CL, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6eqeA (A:)
    mnfprasrlmqaavlgglmavsaaataqtnpyargpnptaasleasagpftvrsftvsrp
    sgygagtvyyptnaggtvgaiaivpgytarqssikwwgprlashgfvvitidtnstldqp
    ssrssqqmaalrqvaslngtssspiygkvdtarmgvmgwsmggggslisaannpslkaaa
    pqapwdsstnfssvtvptlifacendsiapvnssalpiydsmsrnakqfleinggshsca
    nsgnsnqaligkkgvawmkrfmdndtrystfacenpnstrvsdfrtancslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6eqeA (A:)
    tnpyargpnptaasleasagpftvrsftvsrpsgygagtvyyptnaggtvgaiaivpgyt
    arqssikwwgprlashgfvvitidtnstldqpssrssqqmaalrqvaslngtssspiygk
    vdtarmgvmgwsmggggslisaannpslkaaapqapwdsstnfssvtvptlifacendsi
    apvnssalpiydsmsrnakqfleinggshscansgnsnqaligkkgvawmkrfmdndtry
    stfacenpnstrvsdfrtancsleh