PDB entry 6eq9

View 6eq9 on RCSB PDB site
Description: Crystal structure of JNK3 in complex with AMP-PCP
Class: transferase
Keywords: Protein Kinase Activiy Map Kinase Activity ATP Binding Protein Phosphorylation, TRANSFERASE
Deposited on 2017-10-12, released 2018-08-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-08, with a file datestamp of 2018-08-03.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 10
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK10, JNK3, JNK3A, PRKM10, SAPK1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6eq9a_
  • Chain 'B':
    Compound: Mitogen-activated protein kinase 10
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK10, JNK3, JNK3A, PRKM10, SAPK1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6eq9b_
  • Heterogens: ACP, MG, NA, BME, C15, PEG, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6eq9A (A:)
    ggsmskskvdnqfysvevgdstftvlkryqnlkpigsgaqgivcaaydavldrnvaikkl
    srpfqnqthakrayrelvlmkcvnhkniisllnvftpqktleefqdvylvmelmdanlcq
    viqmeldhermsyllyqmlcgikhlhsagiihrdlkpsnivvksdctlkildfglartag
    tsfmmtpyvvtryyrapevilgmgykenvdiwsvgcimgemvrhkilfpgrdyidqwnkv
    ieqlgtpcpefmkklqptvrnyvenrpkyagltfpklfpdslfpadsehnklkasqardl
    lskmlvidpakrisvddalqhpyinvwydpaeveapppqiydkqlderehtieewkeliy
    kevmnse
    

    Sequence, based on observed residues (ATOM records): (download)
    >6eq9A (A:)
    nqfysvevgdstftvlkryqnlkpigsgaqgivcaaydavldrnvaikklsrpfqnqtha
    krayrelvlmkcvnhkniisllnvftpqktleefqdvylvmelmdanlcqviqmeldher
    msyllyqmlcgikhlhsagiihrdlkpsnivvksdctlkildfglartagtsfmvtryyr
    apevilgmgykenvdiwsvgcimgemvrhkilfpgrdyidqwnkvieqlgtpcpefmkkl
    qptvrnyvenrpkyagltfpklfpdslfpadsehnklkasqardllskmlvidpakrisv
    ddalqhpyinvwydpaeveapppqiydkqlderehtieewkeliykevmn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6eq9B (B:)
    ggsmskskvdnqfysvevgdstftvlkryqnlkpigsgaqgivcaaydavldrnvaikkl
    srpfqnqthakrayrelvlmkcvnhkniisllnvftpqktleefqdvylvmelmdanlcq
    viqmeldhermsyllyqmlcgikhlhsagiihrdlkpsnivvksdctlkildfglartag
    tsfmmtpyvvtryyrapevilgmgykenvdiwsvgcimgemvrhkilfpgrdyidqwnkv
    ieqlgtpcpefmkklqptvrnyvenrpkyagltfpklfpdslfpadsehnklkasqardl
    lskmlvidpakrisvddalqhpyinvwydpaeveapppqiydkqlderehtieewkeliy
    kevmnse
    

    Sequence, based on observed residues (ATOM records): (download)
    >6eq9B (B:)
    qfysvevgdstftvlkryqnlkpigsgaqgivcaaydavldrnvaikklsrpfqnqthak
    rayrelvlmkcvnhkniisllnvftpqktleefqdvylvmelmdanlcqviqmeldherm
    syllyqmlcgikhlhsagiihrdlkpsnivvksdctlkildfglvtryyrapevilgmgy
    kenvdiwsvgcimgemvrhkilfpgrdyidqwnkvieqlgtpcpefmkklqptvrnyven
    rpkyagltfpklfpdslfpadsehnklkasqardllskmlvidpakrisvddalqhpyin
    vwydpaeveapppqrehtieewkeliykevmn