PDB entry 6eq4

View 6eq4 on RCSB PDB site
Description: MTH1 in complex with fragment 8
Class: hydrolase
Keywords: Inhibitor, Complex, Hydrolase, DNA repair, Fragment
Deposited on 2017-10-12, released 2018-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-31, with a file datestamp of 2018-10-26.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 7,8-dihydro-8-oxoguanine triphosphatase
    Species: Homo sapiens [TaxId:9606]
    Gene: NUDT1, MTH1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6eq4a_
  • Heterogens: BSW, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6eq4A (A:)
    mkhhhhhhpmsdydipttenlyfqgamgasrlytlvlvlqpqrvllgmkkrgfgagrwng
    fggkvqegetiedgarrelqeesgltvdalhkvgqivfefvgepelmdvhvfctdsiqgt
    pvesdemrpcwfqldqipfkdmwpddsywfplllqkkkfhgyfkfqgqdtildytlrevd
    tv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6eq4A (A:)
    asrlytlvlvlqpqrvllgmkkrgfgagrwngfggkvqegetiedgarrelqeesgltvd
    alhkvgqivfefvgepelmdvhvfctdsiqgtpvesdemrpcwfqldqipfkdmwpddsy
    wfplllqkkkfhgyfkfqgqdtildytlrevdtv