PDB entry 6eq0

View 6eq0 on RCSB PDB site
Description: structure of the periplasmic binding protein (pbp) melb (atu4661) in complex with galactose from agrobacterium tumefacien c58
Deposited on 2017-10-12, released 2018-04-11
The last revision was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Periplasmic alpha-galactoside-binding protein
    Species: Rhizobium radiobacter [TaxId:358]
    Gene: SY94_4618
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A083ZM57 (Start-676)
      • expression tag (677)
  • Chain 'B':
    Compound: Periplasmic alpha-galactoside-binding protein
    Species: Rhizobium radiobacter [TaxId:358]
    Gene: SY94_4618
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A083ZM57 (Start-676)
      • expression tag (677)
  • Heterogens: GLA, PEG, EDO, CL, CA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6eq0A (A:)
    mialsanafetttppeppqfpaegkinyvardtilefkalpsysepdwitekfekagklp
    plkerlpeeplvyktgnmpdgvgvygdtmrhvvggrpegwnyiagqsqgwggidialsec
    ltrtaplfqvdakdteplpnlakswewsedghtltmhlvkgakwsdgeafnaddvmfywe
    davvdpnvsplgggaspeafgegttlkkiddytvewtfkaafpkqylytmaypsfcpgps
    hilkpqhpkyskntynqfknafppeymnmpvmgawvpvsyrpddlivlrrnpyywkvdek
    gqqlpylnevhyklstwadrdvqavagsgdfsnleqpenfvaslkraadpnaparlafgp
    rligynlqmnfsangwgnpdergqairelnrnevfrqavtsaldrkaigdslvkgpftai
    ypggissgtsfydrastvyypfnlegakaalasiglkdtdgdgflnfpketlggrnveit
    llvnngyatdkslaeglvgqmaklglrvvihsldsnqrdaahyggqfdwlvrrnstelss
    vvqnteqlapvgprtswnhrspegkeldlmpfekemadivrkfissqdnaeradlmkqyq
    kvytqnlytiglteypgalivnkrfsnvpqgtpifmfnwaedaiirerlwvaadkqgkye
    lfpqqlpgkpgeggpinhhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >6eq0A (A:)
    afetttppeppqfpaegkinyvardtilefkalpsysepdwitekfekagklpplkerlp
    eeplvyktgnmpdgvgvygdtmrhvvggrpegwnyiagqsqgwggidialsecltrtapl
    fqvdakdteplpnlakswewsedghtltmhlvkgakwsdgeafnaddvmfywedavvdpn
    vsplgggaspeafgegttlkkiddytvewtfkaafpkqylytmaypsfcpgpshilkpqh
    pkyskntynqfknafppeymnmpvmgawvpvsyrpddlivlrrnpyywkvdekgqqlpyl
    nevhyklstwadrdvqavagsgdfsnleqpenfvaslkraadpnaparlafgprligynl
    qmnfsangwgnpdergqairelnrnevfrqavtsaldrkaigdslvkgpftaiypggiss
    gtsfydrastvyypfnlegakaalasiglkdtdgdgflnfpketlggrnveitllvnngy
    atdkslaeglvgqmaklglrvvihsldsnqrdaahyggqfdwlvrrnstelssvvqnteq
    lapvgprtswnhrspegkeldlmpfekemadivrkfissqdnaeradlmkqyqkvytqnl
    ytiglteypgalivnkrfsnvpqgtpifmfnwaedaiirerlwvaadkqgkyelfpqqlp
    gkpgeggpinh
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6eq0B (B:)
    mialsanafetttppeppqfpaegkinyvardtilefkalpsysepdwitekfekagklp
    plkerlpeeplvyktgnmpdgvgvygdtmrhvvggrpegwnyiagqsqgwggidialsec
    ltrtaplfqvdakdteplpnlakswewsedghtltmhlvkgakwsdgeafnaddvmfywe
    davvdpnvsplgggaspeafgegttlkkiddytvewtfkaafpkqylytmaypsfcpgps
    hilkpqhpkyskntynqfknafppeymnmpvmgawvpvsyrpddlivlrrnpyywkvdek
    gqqlpylnevhyklstwadrdvqavagsgdfsnleqpenfvaslkraadpnaparlafgp
    rligynlqmnfsangwgnpdergqairelnrnevfrqavtsaldrkaigdslvkgpftai
    ypggissgtsfydrastvyypfnlegakaalasiglkdtdgdgflnfpketlggrnveit
    llvnngyatdkslaeglvgqmaklglrvvihsldsnqrdaahyggqfdwlvrrnstelss
    vvqnteqlapvgprtswnhrspegkeldlmpfekemadivrkfissqdnaeradlmkqyq
    kvytqnlytiglteypgalivnkrfsnvpqgtpifmfnwaedaiirerlwvaadkqgkye
    lfpqqlpgkpgeggpinhhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >6eq0B (B:)
    afetttppeppqfpaegkinyvardtilefkalpsysepdwitekfekagklpplkerlp
    eeplvyktgnmpdgvgvygdtmrhvvggrpegwnyiagqsqgwggidialsecltrtapl
    fqvdakdteplpnlakswewsedghtltmhlvkgakwsdgeafnaddvmfywedavvdpn
    vsplgggaspeafgegttlkkiddytvewtfkaafpkqylytmaypsfcpgpshilkpqh
    pkyskntynqfknafppeymnmpvmgawvpvsyrpddlivlrrnpyywkvdekgqqlpyl
    nevhyklstwadrdvqavagsgdfsnleqpenfvaslkraadpnaparlafgprligynl
    qmnfsangwgnpdergqairelnrnevfrqavtsaldrkaigdslvkgpftaiypggiss
    gtsfydrastvyypfnlegakaalasiglkdtdgdgflnfpketlggrnveitllvnngy
    atdkslaeglvgqmaklglrvvihsldsnqrdaahyggqfdwlvrrnstelssvvqnteq
    lapvgprtswnhrspegkeldlmpfekemadivrkfissqdnaeradlmkqyqkvytqnl
    ytiglteypgalivnkrfsnvpqgtpifmfnwaedaiirerlwvaadkqgkyelfpqqlp
    gkpgeggpinh