PDB entry 6epm

View 6epm on RCSB PDB site
Description: Ras guanine nucleotide exchange factor SOS1 (Rem-cdc25) in complex with KRAS(G12C) and fragment screening hit F1
Class: signaling protein
Keywords: Guanine nucleotide exchange factor, GEF, Fragment Screen, GTPASE, SIGNALING PROTEIN
Deposited on 2017-10-12, released 2019-02-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-06, with a file datestamp of 2019-02-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'R':
    Compound: GTPase KRas
    Species: Homo sapiens [TaxId:9606]
    Gene: KRAS, KRAS2, RASK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01116 (1-169)
      • engineered mutation (12)
      • engineered mutation (118)
      • engineered mutation (126-128)
    Domains in SCOPe 2.07: d6epmr_
  • Chain 'S':
    Compound: Son of sevenless homolog 1
    Species: Homo sapiens [TaxId:9606]
    Gene: SOS1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6epms_
  • Heterogens: BQ5, GOL, HOH

PDB Chain Sequences:

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >6epmR (R:)
    gmteyklvvvgacgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildta
    gqeeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnksd
    lpsrtvesrqaqdlarsygipfietsaktrqgvddafytlvreirkhkek
    

    Sequence, based on observed residues (ATOM records): (download)
    >6epmR (R:)
    mteyklvvvgacgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
    qeeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnksdl
    psrtvesrqaqdlarsygipfietsaktrqgvddafytlvreirkhkek
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >6epmS (S:)
    geeqmrlpsadvyrfaepdseeniifeenmqpkagipiikagtviklierltyhmyadpn
    fvrtflttyrsfckpqellsliierfeipepepteadriaiengdqplsaelkrfrkeyi
    qpvqlrvlnvcrhwvehhfydferdayllqrmeefigtvrgkamkkwvesitkiiqrkki
    ardngpghnitfqsspptvewhisrpghietfdlltlhpieiarqltllesdlyravqps
    elvgsvwtkedkeinspnllkmirhttnltlwfekcivetenleervavvsriieilqvf
    qelnnfngvlevvsamnsspvyrldhtfeqipsrqkkileeahelsedhykkylaklrsi
    nppcvpffgiyltnilkteegnpevlkrhgkelinfskrrkvaeitgeiqqyqnqpyclr
    vesdikrffenlnpmgnsmekeftdylfnksleieprnpkplprfpkkysyplkspgvrp
    snprpgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >6epmS (S:)
    eqmrlpsadvyrfaepdseeniifeenmqpkagipiikagtviklierltyhmyadpnfv
    rtflttyrsfckpqellsliierfeipepepteasaelkrfrkeyiqpvqlrvlnvcrhw
    vehhfydferdayllqrmeefigtvrgkamkkwvesitkiiqrkkiaitfqsspptvewh
    isrpghietfdlltlhpieiarqltllesdlyravqpselvgsvwtkedkeinspnllkm
    irhttnltlwfekcivetenleervavvsriieilqvfqelnnfngvlevvsamnsspvy
    rldhtfeqipsrqkkileeahelsedhykkylaklrsinppcvpffgiyltnilkteegn
    pevlkrhgkelinfskrrkvaeitgeiqqyqnqpyclrvesdikrffenlnpmgnsmeke
    ftdylfnksleieprnpkplprfpkkysyplkspgvrpsnpr