PDB entry 6epa

View 6epa on RCSB PDB site
Description: Structure of dNCS-1 bound to the NCS-1/Ric8a protein/protein interaction regulator IGS-1.76
Class: signaling protein
Keywords: Calcium sensor, synapse regulation, SIGNALING PROTEIN
Deposited on 2017-10-11, released 2018-08-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-29, with a file datestamp of 2018-08-24.
Experiment type: XRAY
Resolution: 1.82 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fi18190p1
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: Frq2, DmelCG5907, Frq, frq, frq2, Frq2-RA, CG5907, Dmel_CG5907
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9VWX8
      • engineered mutation (177)
    Domains in SCOPe 2.07: d6epaa_
  • Heterogens: CA, BNQ, PG0, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6epaA (A:)
    mgkknsklkqdtidrlttdtyftekeirqwhkgflkdcpngllteqgfikiykqffpdgd
    pskfaslvfrvfdenndgaiefeefiralsitsrgnldeklhwafrlydvdndgyitree
    mynivdaiyqmvgqqpqtedentpqkrvdkifdqmdknhddrltleefregskadprmvq
    alslggd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6epaA (A:)
    kknsklkqdtidrlttdtyftekeirqwhkgflkdcpngllteqgfikiykqffpdgdps
    kfaslvfrvfdenndgaiefeefiralsitsrgnldeklhwafrlydvdndgyitreemy
    nivdaiyqmvgqqpqtedentpqkrvdkifdqmdknhddrltleefregskadprmvqal
    slg