PDB entry 6ep9

View 6ep9 on RCSB PDB site
Description: Crystal structure of BTK kinase domain complexed with N-[2-methyl-3-[4-methyl-6-[4-(4-methylpiperazine-1-carbonyl)anilino]-5-oxo-pyrazin-2-yl]phenyl]-4-(1-piperidyl)benzamide
Class: transferase
Keywords: kinase-inhibitor complex, transferase
Deposited on 2017-10-11, released 2018-08-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-22, with a file datestamp of 2018-08-17.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase BTK
    Species: Homo sapiens [TaxId:9606]
    Gene: BTK, AGMX1, ATK, BPK
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q06187
      • engineered mutation (112)
      • engineered mutation (115)
      • engineered mutation (247-248)
    Domains in SCOPe 2.07: d6ep9a_
  • Heterogens: BNB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ep9A (A:)
    gsqqnknapstaglgygsweidpkdltflkelgtgqfgvvkygkwrgqydvaikmikegs
    msedefieeakvmmnlsheklvqlygvctkqrpifiiteymangcllnylrearhafqtq
    qllemckdvceameyleskqflhrdlaarnclvndqgvvkvsdfglsryvlddeytssvg
    skfpvrwsppevlmyskfssksdiwafgvlmweiyslgkmpyerftnsetaehiaqglrl
    yrphlasaavytimyscwhekaderptfkillsnildvmdees
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ep9A (A:)
    eidpkdltflkelgtgqfgvvkygkwrgqydvaikmikegsmsedefieeakvmmnlshe
    klvqlygvctkqrpifiiteymangcllnylrearhafqtqqllemckdvceameylesk
    qflhrdlaarnclvndqgvvkvsdfglsryvlddeytssvgskfpvrwsppevlmyskfs
    sksdiwafgvlmweiyslgkmpyerftnsetaehiaqglrlyrphlasaavytimyscwh
    ekaderptfkillsnildvmdee