PDB entry 6ep8

View 6ep8 on RCSB PDB site
Description: InhA Y158F mutant in complex with NADH from Mycobacterium tuberculosis
Class: oxidoreductase
Keywords: mycolic acid biosynthetic process, oxidoreductase, therapeutic target, isoniazid, mutation, catalytic mechanism, enoyl thioester reductases, tuberculosis
Deposited on 2017-10-11, released 2018-09-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-19, with a file datestamp of 2018-09-14.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH]
    Species: MYCOBACTERIUM TUBERCULOSIS H37RV [TaxId:83332]
    Gene: inhA, Rv1484, MTCY277.05
    Database cross-references and differences (RAF-indexed):
    • Uniprot P9WGR1 (Start-271)
      • engineered mutation (160)
    Domains in SCOPe 2.07: d6ep8a_
  • Heterogens: NA, NAD, GOL, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ep8A (A:)
    gshmtglldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpak
    aplleldvqneehlaslagrvteaigagnkldgvvhsigfmpqtgmginpffdapyadvs
    kgihisaysyasmakallpimnpggsivgmdfdpsrampafnwmtvaksalesvnrfvar
    eagkygvrsnlvaagpirtlamsaivggalgeeagaqiqlleegwdqrapigwnmkdatp
    vaktvcallsdwlpattgdiiyadggahtqll
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ep8A (A:)
    tglldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpakapll
    eldvqneehlaslagrvteaigagnkldgvvhsigfmpqtgmginpffdapyadvskgih
    isaysyasmakallpimnpggsivgmdfdpsrampafnwmtvaksalesvnrfvareagk
    ygvrsnlvaagpirtlamsaivggalgeeagaqiqlleegwdqrapigwnmkdatpvakt
    vcallsdwlpattgdiiyadggahtqll