PDB entry 6ep6

View 6ep6 on RCSB PDB site
Description: ARABIDOPSIS THALIANA GSTU23, reduced
Class: transferase
Keywords: transferase, tau class, peroxidase
Deposited on 2017-10-10, released 2018-04-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-11, with a file datestamp of 2018-04-06.
Experiment type: XRAY
Resolution: 1.59 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutathione S-transferase U23
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: GSTU23, At1g78320, F3F9.14
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ep6a1, d6ep6a2
  • Chain 'B':
    Compound: Glutathione S-transferase U23
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: GSTU23, At1g78320, F3F9.14
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ep6b1, d6ep6b2
  • Heterogens: MG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ep6A (A:)
    meeeiilldywasmygmrtrialeekkvkyeyreedlsnksplllqmnpihkkipvlihe
    gkpicesiiqvqyidelwpdtnpilpsdpyqraqarfwadyidkktyvpckalwsesgek
    qeaakiefievlktldselgdkyyfggnefglvdiafigfyswfrtyeevanlsivlefp
    klmawaqrclkresvakalpdsdkvlksvsdhrkiilgid
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ep6A (A:)
    eiilldywasmygmrtrialeekkvkyeyreedlsnksplllqmnpihkkipvlihegkp
    icesiiqvqyidelwpdtnpilpsdpyqraqarfwadyidkktyvpckalwsesgekqea
    akiefievlktldselgdkyyfggnefglvdiafigfyswfrtyeevanlsivlefpklm
    awaqrclkresvakalpdsdkvlksvsdhrki
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6ep6B (B:)
    meeeiilldywasmygmrtrialeekkvkyeyreedlsnksplllqmnpihkkipvlihe
    gkpicesiiqvqyidelwpdtnpilpsdpyqraqarfwadyidkktyvpckalwsesgek
    qeaakiefievlktldselgdkyyfggnefglvdiafigfyswfrtyeevanlsivlefp
    klmawaqrclkresvakalpdsdkvlksvsdhrkiilgid
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ep6B (B:)
    eiilldywasmygmrtrialeekkvkyeyreedlsnksplllqmnpihkkipvlihegkp
    icesiiqvqyidelwpdtnpilpsdpyqraqarfwadyidkktyvpckalwsesgekqea
    akiefievlktldselgdkyyfggnefglvdiafigfyswfrtyeevanlsivlefpklm
    awaqrclkresvakalpdsdkvlksvsdhrkiilgi