PDB entry 6ep1

View 6ep1 on RCSB PDB site
Description: Transthyretin in complex with 5-(4-nitrophenylazo)-3-iodosalicylic acid
Class: transport protein
Keywords: Amyloid inhibitor, FAP inhibitor, transthyretin, TRANSPORT PROTEIN
Deposited on 2017-10-10, released 2018-10-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-10-31, with a file datestamp of 2018-10-26.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR, PALB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6ep1a_
  • Chain 'B':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR, PALB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6ep1b_
  • Heterogens: BQB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6ep1A (A:)
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6ep1B (B:)
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn