PDB entry 6eot

View 6eot on RCSB PDB site
Description: dpp8 - slrflyeg, space group 19
Deposited on 2017-10-10, released 2018-02-07
The last revision was dated 2019-10-09, with a file datestamp of 2019-10-04.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: N/A
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dipeptidyl peptidase 8
    Species: Homo sapiens [TaxId:9606]
    Gene: DPP8, DPRP1, MSTP097, MSTP135, MSTP141
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Dipeptidyl peptidase 8
    Species: Homo sapiens [TaxId:9606]
    Gene: DPP8, DPRP1, MSTP097, MSTP135, MSTP141
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: ser-leu-arg-phe-leu-tyr-glu-gly
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6EOT (0-7)
  • Chain 'D':
    Compound: Dipeptidyl peptidase 8
    Species: Homo sapiens [TaxId:9606]
    Gene: DPP8, DPRP1, MSTP097, MSTP135, MSTP141
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: ser-leu-arg-phe-leu-tyr-glu-gly
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6EOT (0-7)
  • Chain 'F':
    Compound: ser-leu-arg-phe-leu-tyr-glu-gly
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6EOT (0-7)
  • Chain 'G':
    Compound: Dipeptidyl peptidase 8
    Species: Homo sapiens [TaxId:9606]
    Gene: DPP8, DPRP1, MSTP097, MSTP135, MSTP141
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: ser-leu-arg-phe-leu-tyr-glu-gly
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6EOT (0-7)
  • Chain 'I':
    Compound: Dipeptidyl peptidase 8
    Species: Homo sapiens [TaxId:9606]
    Gene: DPP8, DPRP1, MSTP097, MSTP135, MSTP141
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: ser-leu-arg-phe-leu-tyr-glu-gly
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6EOT (0-7)
  • Chain 'K':
    Compound: Dipeptidyl peptidase 8
    Species: Homo sapiens [TaxId:9606]
    Gene: DPP8, DPRP1, MSTP097, MSTP135, MSTP141
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: ser-leu-arg-phe-leu-tyr-glu-gly
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6EOT (0-7)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6eotA (A:)
    mwkrseqmkiksgkcnmaaameteqlgveifetadceeniesqdrpklepfyveryswsq
    lkklladtrkyhgymmakaphdfmfvkrndpdgphsdriyylamsgenrentlfyseipk
    tinraavlmlswkplldlfqatldygmysreeellrerkrigtvgiasydyhqgsgtflf
    qagsgiyhvkdggpqgftqqplrpnlvetscpnirmdpklcpadpdwiafihsndiwisn
    ivtreerrltyvhnelanmeedarsagvatfvlqeefdrysgywwcpkaettpsggkilr
    ilyeendeseveiihvtspmletrradsfrypktgtanpkvtfkmseimidaegriidvi
    dkeliqpfeilfegveyiaragwtpegkyawsilldrsqtrlqivlispelfipveddvm
    erqrliesvpdsvtpliiyeettdiwinihdifhvfpqsheeeiefifasecktgfrhly
    kitsilkeskykrssgglpapsdfkcpikeeiaitsgewevlgrhgsniqvdevrrlvyf
    egtkdsplehhlyvvsyvnpgevtrltdrgyshsccisqhcdffiskysnqknphcvsly
    klsspeddptcktkefwatildsagplpdytppeifsfesttgftlygmlykphdlqpgk
    kyptvlfiyggpqvqlvnnrfkgvkyfrlntlaslgyvvvvidnrgschrglkfegafky
    kmgqieiddqveglqylasrydfidldrvgihgwsyggylslmalmqrsdifrvaiagap
    vtlwifydtgyterymghpdqneqgyylgsvamqaekfpsepnrllllhgfldenvhfah
    tsillsflvragkpydlqiypqerhsirvpesgehyelhllhylqenlgsriaalkvi
    

    Sequence, based on observed residues (ATOM records):
    >6eotA (A:)
    lepfyveryswsqlkklladtrkyhkaphdfmfvkrndpdgphsdriyylamrentlfys
    eipktinraavlmlswkplldlysreeellrerkrigtvgiasydyhqgsgtflfqagsg
    iyhvkdggpqgftqqplrpnlvetscpnirmdpklcpadpdwiafihsndiwisnivtre
    errltyvhnelanmeedarsagvatfvlqeefdrysgywwcpkaettpsggkilrilyee
    ndeseveiihvtspmletrradsfrypktgtanpkvtfkmseimidaegriidvidkeli
    qpfeilfegveyiaragwtpegkyawsilldrsqtrlqivlispelfipveddvmerqrl
    iesvpdsvtpliiyeettdiwinihdifhvfpqsheeeiefifasecktgfrhlykitsi
    lkeskykrssgglpapsdfkcpikeeiaitsgewevlgrhgsniqvdevrrlvyfegtkd
    splehhlyvvsyvnpgevtrltdrgyshsccisqhcdffiskysnqknphcvslyklssp
    eddptcktkefwatildsagplpdytppeifsfesttgftlygmlykphdlqpgkkyptv
    lfiyggpqvqlvnnrfkgvkyfrlntlaslgyvvvvidnrgschrglkfegafkykmgqi
    eiddqveglqylasrydfidldrvgihgwsyggylslmalmqrsdifrvaiagapvtlwi
    fydtgyterymghpdqneqgyylgsvamqaekfpsepnrllllhgfldenvhfahtsill
    sflvragkpydlqiypqerhsirvpesgehyelhllhylqenlgsriaalkv
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6eotB (B:)
    mwkrseqmkiksgkcnmaaameteqlgveifetadceeniesqdrpklepfyveryswsq
    lkklladtrkyhgymmakaphdfmfvkrndpdgphsdriyylamsgenrentlfyseipk
    tinraavlmlswkplldlfqatldygmysreeellrerkrigtvgiasydyhqgsgtflf
    qagsgiyhvkdggpqgftqqplrpnlvetscpnirmdpklcpadpdwiafihsndiwisn
    ivtreerrltyvhnelanmeedarsagvatfvlqeefdrysgywwcpkaettpsggkilr
    ilyeendeseveiihvtspmletrradsfrypktgtanpkvtfkmseimidaegriidvi
    dkeliqpfeilfegveyiaragwtpegkyawsilldrsqtrlqivlispelfipveddvm
    erqrliesvpdsvtpliiyeettdiwinihdifhvfpqsheeeiefifasecktgfrhly
    kitsilkeskykrssgglpapsdfkcpikeeiaitsgewevlgrhgsniqvdevrrlvyf
    egtkdsplehhlyvvsyvnpgevtrltdrgyshsccisqhcdffiskysnqknphcvsly
    klsspeddptcktkefwatildsagplpdytppeifsfesttgftlygmlykphdlqpgk
    kyptvlfiyggpqvqlvnnrfkgvkyfrlntlaslgyvvvvidnrgschrglkfegafky
    kmgqieiddqveglqylasrydfidldrvgihgwsyggylslmalmqrsdifrvaiagap
    vtlwifydtgyterymghpdqneqgyylgsvamqaekfpsepnrllllhgfldenvhfah
    tsillsflvragkpydlqiypqerhsirvpesgehyelhllhylqenlgsriaalkvi
    

    Sequence, based on observed residues (ATOM records):
    >6eotB (B:)
    lepfyveryswsqlkklladtrkyhkaphdfmfvkrndpdgphsdriyylamrentlfys
    eipktinraavlmlswkplldlysreeellrerkrigtvgiasydyhqgsgtflfqagsg
    iyhvkdggpqgftqqplrpnlvetscpnirmdpklcpadpdwiafihsndiwisnivtre
    errltyvhnelanmeedarsagvatfvlqeefdrysgywwcpkaettpsggkilrilyee
    ndeseveiihvtspmletrradsfrypktgtanpkvtfkmseimidaegriidvidkeli
    qpfeilfegveyiaragwtpegkyawsilldrsqtrlqivlispelfipveddvmerqrl
    iesvpdsvtpliiyeettdiwinihdifhvfpqsheeeiefifasecktgfrhlykitsi
    lkeskykrssgglpapsdfkcpikeeiaitsgewevlgrhgsniqvdevrrlvyfegtkd
    splehhlyvvsyvnpgevtrltdrgyshsccisqhcdffiskysnqknphcvslyklssp
    eddptcktkefwatildsagplpdytppeifsfesttgftlygmlykphdlqpgkkyptv
    lfiyggpqvqlvnnrfkgvkyfrlntlaslgyvvvvidnrgschrglkfegafkykmgqi
    eiddqveglqylasrydfidldrvgihgwsyggylslmalmqrsdifrvaiagapvtlwi
    fydtgyterymghpdqneqgyylgsvamqaekfpsepnrllllhgfldenvhfahtsill
    sflvragkpydlqiypqerhsirvpesgehyelhllhylqenlgsriaalkv
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >6eotC (C:)
    slrflyeg
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >6eotD (D:)
    mwkrseqmkiksgkcnmaaameteqlgveifetadceeniesqdrpklepfyveryswsq
    lkklladtrkyhgymmakaphdfmfvkrndpdgphsdriyylamsgenrentlfyseipk
    tinraavlmlswkplldlfqatldygmysreeellrerkrigtvgiasydyhqgsgtflf
    qagsgiyhvkdggpqgftqqplrpnlvetscpnirmdpklcpadpdwiafihsndiwisn
    ivtreerrltyvhnelanmeedarsagvatfvlqeefdrysgywwcpkaettpsggkilr
    ilyeendeseveiihvtspmletrradsfrypktgtanpkvtfkmseimidaegriidvi
    dkeliqpfeilfegveyiaragwtpegkyawsilldrsqtrlqivlispelfipveddvm
    erqrliesvpdsvtpliiyeettdiwinihdifhvfpqsheeeiefifasecktgfrhly
    kitsilkeskykrssgglpapsdfkcpikeeiaitsgewevlgrhgsniqvdevrrlvyf
    egtkdsplehhlyvvsyvnpgevtrltdrgyshsccisqhcdffiskysnqknphcvsly
    klsspeddptcktkefwatildsagplpdytppeifsfesttgftlygmlykphdlqpgk
    kyptvlfiyggpqvqlvnnrfkgvkyfrlntlaslgyvvvvidnrgschrglkfegafky
    kmgqieiddqveglqylasrydfidldrvgihgwsyggylslmalmqrsdifrvaiagap
    vtlwifydtgyterymghpdqneqgyylgsvamqaekfpsepnrllllhgfldenvhfah
    tsillsflvragkpydlqiypqerhsirvpesgehyelhllhylqenlgsriaalkvi
    

    Sequence, based on observed residues (ATOM records):
    >6eotD (D:)
    lepfyveryswsqlkklladtrkyhkaphdfmfvkrndpdgphsdriyylamrentlfys
    eipktinraavlmlswkplldlysreeellrerkrigtvgiasydyhqgsgtflfqagsg
    iyhvkdggpqgftqqplrpnlvetscpnirmdpklcpadpdwiafihsndiwisnivtre
    errltyvhnelanmeedarsagvatfvlqeefdrysgywwcpkaettpsggkilrilyee
    ndeseveiihvtspmletrradsfrypktgtanpkvtfkmseimidaegriidvidkeli
    qpfeilfegveyiaragwtpegkyawsilldrsqtrlqivlispelfipveddvmerqrl
    iesvpdsvtpliiyeettdiwinihdifhvfpqsheeeiefifasecktgfrhlykitsi
    lkeskykrssgglpapsdfkcpikeeiaitsgewevlgrhgsniqvdevrrlvyfegtkd
    splehhlyvvsyvnpgevtrltdrgyshsccisqhcdffiskysnqknphcvslyklssp
    eddptcktkefwatildsagplpdytppeifsfesttgftlygmlykphdlqpgkkyptv
    lfiyggpqvqlvnnrfkgvkyfrlntlaslgyvvvvidnrgschrglkfegafkykmgqi
    eiddqveglqylasrydfidldrvgihgwsyggylslmalmqrsdifrvaiagapvtlwi
    fydtgyterymghpdqneqgyylgsvamqaekfpsepnrllllhgfldenvhfahtsill
    sflvragkpydlqiypqerhsirvpesgehyelhllhylqenlgsriaalkv
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records:
    >6eotE (E:)
    slrflyeg
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records:
    >6eotF (F:)
    slrflyeg
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >6eotG (G:)
    mwkrseqmkiksgkcnmaaameteqlgveifetadceeniesqdrpklepfyveryswsq
    lkklladtrkyhgymmakaphdfmfvkrndpdgphsdriyylamsgenrentlfyseipk
    tinraavlmlswkplldlfqatldygmysreeellrerkrigtvgiasydyhqgsgtflf
    qagsgiyhvkdggpqgftqqplrpnlvetscpnirmdpklcpadpdwiafihsndiwisn
    ivtreerrltyvhnelanmeedarsagvatfvlqeefdrysgywwcpkaettpsggkilr
    ilyeendeseveiihvtspmletrradsfrypktgtanpkvtfkmseimidaegriidvi
    dkeliqpfeilfegveyiaragwtpegkyawsilldrsqtrlqivlispelfipveddvm
    erqrliesvpdsvtpliiyeettdiwinihdifhvfpqsheeeiefifasecktgfrhly
    kitsilkeskykrssgglpapsdfkcpikeeiaitsgewevlgrhgsniqvdevrrlvyf
    egtkdsplehhlyvvsyvnpgevtrltdrgyshsccisqhcdffiskysnqknphcvsly
    klsspeddptcktkefwatildsagplpdytppeifsfesttgftlygmlykphdlqpgk
    kyptvlfiyggpqvqlvnnrfkgvkyfrlntlaslgyvvvvidnrgschrglkfegafky
    kmgqieiddqveglqylasrydfidldrvgihgwsyggylslmalmqrsdifrvaiagap
    vtlwifydtgyterymghpdqneqgyylgsvamqaekfpsepnrllllhgfldenvhfah
    tsillsflvragkpydlqiypqerhsirvpesgehyelhllhylqenlgsriaalkvi
    

    Sequence, based on observed residues (ATOM records):
    >6eotG (G:)
    lepfyveryswsqlkklladtrkyhkaphdfmfvkrndpdgphsdriyylamrentlfys
    eipktinraavlmlswkplldlfqatysreeellrerkrigtvgiasydyhqgsgtflfq
    agsgiyhvkdggpqgftqqplrpnlvetscpnirmdpklcpadpdwiafihsndiwisni
    vtreerrltyvhnelanmeedarsagvatfvlqeefdrysgywwcpkaettpsggkilri
    lyeendeseveiihvtspmletrradsfrypktgtanpkvtfkmseimidaegriidvid
    keliqpfeilfegveyiaragwtpegkyawsilldrsqtrlqivlispelfipveddvme
    rqrliesvpdsvtpliiyeettdiwinihdifhvfpqsheeeiefifasecktgfrhlyk
    itsilkeskykrssgglpapsdfkcpikeeiaitsgewevlgrhgsniqvdevrrlvyfe
    gtkdsplehhlyvvsyvnpgevtrltdrgyshsccisqhcdffiskysnqknphcvslyk
    lsspeddptcktkefwatildsagplpdytppeifsfesttgftlygmlykphdlqpgkk
    yptvlfiyggpqvqlvnnrfkgvkyfrlntlaslgyvvvvidnrgschrglkfegafkyk
    mgqieiddqveglqylasrydfidldrvgihgwsyggylslmalmqrsdifrvaiagapv
    tlwifydtgyterymghpdqneqgyylgsvamqaekfpsepnrllllhgfldenvhfaht
    sillsflvragkpydlqiypqerhsirvpesgehyelhllhylqenlgsriaalkv
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records:
    >6eotH (H:)
    slrflyeg
    

  • Chain 'I':
    Sequence, based on SEQRES records:
    >6eotI (I:)
    mwkrseqmkiksgkcnmaaameteqlgveifetadceeniesqdrpklepfyveryswsq
    lkklladtrkyhgymmakaphdfmfvkrndpdgphsdriyylamsgenrentlfyseipk
    tinraavlmlswkplldlfqatldygmysreeellrerkrigtvgiasydyhqgsgtflf
    qagsgiyhvkdggpqgftqqplrpnlvetscpnirmdpklcpadpdwiafihsndiwisn
    ivtreerrltyvhnelanmeedarsagvatfvlqeefdrysgywwcpkaettpsggkilr
    ilyeendeseveiihvtspmletrradsfrypktgtanpkvtfkmseimidaegriidvi
    dkeliqpfeilfegveyiaragwtpegkyawsilldrsqtrlqivlispelfipveddvm
    erqrliesvpdsvtpliiyeettdiwinihdifhvfpqsheeeiefifasecktgfrhly
    kitsilkeskykrssgglpapsdfkcpikeeiaitsgewevlgrhgsniqvdevrrlvyf
    egtkdsplehhlyvvsyvnpgevtrltdrgyshsccisqhcdffiskysnqknphcvsly
    klsspeddptcktkefwatildsagplpdytppeifsfesttgftlygmlykphdlqpgk
    kyptvlfiyggpqvqlvnnrfkgvkyfrlntlaslgyvvvvidnrgschrglkfegafky
    kmgqieiddqveglqylasrydfidldrvgihgwsyggylslmalmqrsdifrvaiagap
    vtlwifydtgyterymghpdqneqgyylgsvamqaekfpsepnrllllhgfldenvhfah
    tsillsflvragkpydlqiypqerhsirvpesgehyelhllhylqenlgsriaalkvi
    

    Sequence, based on observed residues (ATOM records):
    >6eotI (I:)
    lepfyveryswsqlkklladtrkyhkaphdfmfvkrndpdgphsdriyylamrentlfys
    eipktinraavlmlswkplldlysreeellrerkrigtvgiasydyhqgsgtflfqagsg
    iyhvkdggpqgftqqplrpnlvetscpnirmdpklcpadpdwiafihsndiwisnivtre
    errltyvhnelanmeedarsagvatfvlqeefdrysgywwcpkaettpsggkilrilyee
    ndeseveiihvtspmletrradsfrypktgtanpkvtfkmseimidaegriidvidkeli
    qpfeilfegveyiaragwtpegkyawsilldrsqtrlqivlispelfipveddvmerqrl
    iesvpdsvtpliiyeettdiwinihdifhvfpqsheeeiefifasecktgfrhlykitsi
    lkeskykrssgglpapsdfkcpikeeiaitsgewevlgrhgsniqvdevrrlvyfegtkd
    splehhlyvvsyvnpgevtrltdrgyshsccisqhcdffiskysnqknphcvslyklssp
    eddptcktkefwatildsagplpdytppeifsfesttgftlygmlykphdlqpgkkyptv
    lfiyggpqvqlvnnrfkgvkyfrlntlaslgyvvvvidnrgschrglkfegafkykmgqi
    eiddqveglqylasrydfidldrvgihgwsyggylslmalmqrsdifrvaiagapvtlwi
    fydtgyterymghpdqneqgyylgsvamqaekfpsepnrllllhgfldenvhfahtsill
    sflvragkpydlqiypqerhsirvpesgehyelhllhylqenlgsriaalkv
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records:
    >6eotJ (J:)
    slrflyeg
    

  • Chain 'K':
    Sequence, based on SEQRES records:
    >6eotK (K:)
    mwkrseqmkiksgkcnmaaameteqlgveifetadceeniesqdrpklepfyveryswsq
    lkklladtrkyhgymmakaphdfmfvkrndpdgphsdriyylamsgenrentlfyseipk
    tinraavlmlswkplldlfqatldygmysreeellrerkrigtvgiasydyhqgsgtflf
    qagsgiyhvkdggpqgftqqplrpnlvetscpnirmdpklcpadpdwiafihsndiwisn
    ivtreerrltyvhnelanmeedarsagvatfvlqeefdrysgywwcpkaettpsggkilr
    ilyeendeseveiihvtspmletrradsfrypktgtanpkvtfkmseimidaegriidvi
    dkeliqpfeilfegveyiaragwtpegkyawsilldrsqtrlqivlispelfipveddvm
    erqrliesvpdsvtpliiyeettdiwinihdifhvfpqsheeeiefifasecktgfrhly
    kitsilkeskykrssgglpapsdfkcpikeeiaitsgewevlgrhgsniqvdevrrlvyf
    egtkdsplehhlyvvsyvnpgevtrltdrgyshsccisqhcdffiskysnqknphcvsly
    klsspeddptcktkefwatildsagplpdytppeifsfesttgftlygmlykphdlqpgk
    kyptvlfiyggpqvqlvnnrfkgvkyfrlntlaslgyvvvvidnrgschrglkfegafky
    kmgqieiddqveglqylasrydfidldrvgihgwsyggylslmalmqrsdifrvaiagap
    vtlwifydtgyterymghpdqneqgyylgsvamqaekfpsepnrllllhgfldenvhfah
    tsillsflvragkpydlqiypqerhsirvpesgehyelhllhylqenlgsriaalkvi
    

    Sequence, based on observed residues (ATOM records):
    >6eotK (K:)
    lepfyveryswsqlkklladtrkyhkaphdfmfvkrndpdgphsdriyylamrentlfys
    eipktinraavlmlswkplldlysreeellrerkrigtvgiasydyhqgsgtflfqagsg
    iyhvkdggpqgftqqplrpnlvetscpnirmdpklcpadpdwiafihsndiwisnivtre
    errltyvhnelanmeedarsagvatfvlqeefdrysgywwcpkaettpsggkilrilyee
    ndeseveiihvtspmletrradsfrypktgtanpkvtfkmseimidaegriidvidkeli
    qpfeilfegveyiaragwtpegkyawsilldrsqtrlqivlispelfipveddvmerqrl
    iesvpdsvtpliiyeettdiwinihdifhvfpqsheeeiefifasecktgfrhlykitsi
    lkeskykrssgglpapsdfkcpikeeiaitsgewevlgrhgsniqvdevrrlvyfegtkd
    splehhlyvvsyvnpgevtrltdrgyshsccisqhcdffiskysnqknphcvslyklssp
    eddptcktkefwatildsagplpdytppeifsfesttgftlygmlykphdlqpgkkyptv
    lfiyggpqvqlvnnrfkgvkyfrlntlaslgyvvvvidnrgschrglkfegafkykmgqi
    eiddqveglqylasrydfidldrvgihgwsyggylslmalmqrsdifrvaiagapvtlwi
    fydtgyterymghpdqneqgyylgsvamqaekfpsepnrllllhgfldenvhfahtsill
    sflvragkpydlqiypqerhsirvpesgehyelhllhylqenlgsriaalkv
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records:
    >6eotL (L:)
    slrflyeg