PDB entry 6eon

View 6eon on RCSB PDB site
Description: galactanase bt0290
Deposited on 2017-10-10, released 2017-11-29
The last revision was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-galactosidase
    Species: Bacteroides thetaiotaomicron [TaxId:226186]
    Gene: BT_0290
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8AB22 (Start-778)
      • conflict (181)
  • Heterogens: GLA, CA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6eonA (A:)
    mkkpllyllilvvavlgsscsqssegtfevgkntfllngepfvvkaaeihypripkeywe
    hrikmckalgmnticlyvfwnfhepeegrydfagqkdiaafcrlaqengmyvivrpgpyv
    caewemgglpwwllkkkdiklreqdpyymervklflnevgkqladlqiskggniimvqve
    naygafgidkpyiseirdmvkqagftgvplfqcdwnsnfennalddllwtinfgtganid
    eqfkrlkelrpdtplmcsefwsgwfdhwgakhetrsaeelvkgmkemldrnisfslymth
    ggtsfghwgganfpnfsptctsydydapinesgkvtpkylevrnllgnylpegetlpeip
    dsiptiaiptikmtemavlfdnlphpkesedirtmeafdqgwgsilyrtslsasdkeqtl
    liteahdwaqvflngkklatlsrlkgegvvklpplkegdrldilveamgrmnfgkgiydw
    kgitekvelqsdkgvelvkdwqvytipvdysfardkqykqqenaenqpayyrstfnlnel
    gdtflnmmnwskgmvwvnghaigryweigpqqtlyvpgcwlkkgeneiiildmagpskae
    teglrqpildvqrgngayahrkmgenldltnetpvyqgifksgngwqhvkfgkkvetrff
    clealnahdgkdfaaiaelellgedgkpvsrqhwkviyadseetdaanniatnvfdlqes
    tfwhtnyssskpafphqividlgedkvitgfsylpraeagktgmikdykvylkmqpfki
    

    Sequence, based on observed residues (ATOM records):
    >6eonA (A:)
    gtfevgkntfllngepfvvkaaeihypripkeywehrikmckalgmnticlyvfwnfhep
    eegrydfagqkdiaafcrlaqengmyvivrpgpyvcaewemgglpwwllkkkdiklreqd
    pyymervklflnevgkqladlqiskggniimvqvenaygafgidkpyiseirdmvkqagf
    tgvplfqcdwnsnfennalddllwtinfgtganideqfkrlkelrpdtplmcsefwsgwf
    dhwgakhetrsaeelvkgmkemldrnisfslymthggtsfghwgganfpnfsptctsydy
    dapinesgkvtpkylevrnllgnylpegetlpeipdsiptiaiptikmtemavlfdnlph
    pkesedirtmeafdqgwgsilyrtslsasdkeqtlliteahdwaqvflngkklatlsrlk
    gegvvklpplkegdrldilveamgrmnfgkgiydwkgitekvelqsdkgvelvkdwqvyt
    ipvdysfardkqykqqenaenqpayyrstfnlnelgdtflnmmnwskgmvwvnghaigry
    weigpqqtlyvpgcwlkkgeneiiildmagpskaeteglrqpildvqrgngayahrkmge
    nldltnetpvyqgifksgngwqhvkfgkkvetrffclealnahdgkdfaaiaelellged
    gkpvsrqhwkviyadseetdaanniatnvfdlqestfwhtnyssskpafphqividlged
    kvitgfsylpraeagktgmikdykvylkmqpfki