PDB entry 6eol

View 6eol on RCSB PDB site
Description: Human galectin-3c in complex with a galactose derivative
Class: sugar binding protein
Keywords: sugar binding protein
Deposited on 2017-10-09, released 2018-08-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-10-16, with a file datestamp of 2019-10-11.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Galectin-3
    Species: Homo sapiens [TaxId:9606]
    Gene: LGALS3, MAC2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17931 (1-137)
      • initiating methionine (0)
    Domains in SCOPe 2.08: d6eola1, d6eola2
  • Heterogens: SCN, BKH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6eolA (A:)
    mlivpynlplpggvvprmlitilgtvkpnanrialdfqrgndvafhfnprfnennrrviv
    cntkldnnwgreerqsvfpfesgkpfkiqvlvepdhfkvavndahllqynhrvkklneis
    klgisgdidltsasytmi