PDB entry 6eok

View 6eok on RCSB PDB site
Description: Crystal structure of E. coli L-asparaginase II
Class: hydrolase
Keywords: L-Asparaginase II, hydrolase
Deposited on 2017-10-09, released 2018-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-31, with a file datestamp of 2018-10-26.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: L-asparaginase 2
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: ansB, b2957, JW2924
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6eoka_
  • Chain 'B':
    Compound: L-asparaginase 2
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: ansB, b2957, JW2924
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6eokb_
  • Chain 'C':
    Compound: L-asparaginase 2
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: ansB, b2957, JW2924
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6eokc_
  • Chain 'D':
    Compound: L-asparaginase 2
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: ansB, b2957, JW2924
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6eokd_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6eokA (A:)
    lpnitilatggtiagggdsatksnytvgkvgvenlvnavpqlkdianvkgeqvvnigsqd
    mndnvwltlakkintdcdktdgfvithgtdtmeetayfldltvkcdkpvvmvgamrpsts
    msadgpfnlynavvtaadkasanrgvlvvmndtvldgrdvtktnttdvatfksvnygplg
    yihngkidyqrtparkhtsdtpfdvsklnelpkvgivynyanasdlpakalvdagydgiv
    sagvgngnlyksvfdtlataaktgtavvrssrvptgattqdaevddakygfvasgtlnpq
    karvllqlaltqtkdpqqiqqifnqy
    

    Sequence, based on observed residues (ATOM records): (download)
    >6eokA (A:)
    lpnitilatggtiaavpqlkdianvkgeqvvnigsqdmndnvwltlakkintdcdktdgf
    vithgtdtmeetayfldltvkcdkpvvmvgamrpstsmsadgpfnlynavvtaadkasan
    rgvlvvmndtvldgrdvtktnttdvatfksvnygplgyihngkidyqrtparkhtsdtpf
    dvsklnelpkvgivynyanasdlpakalvdagydgivsagvgngnlyksvfdtlataakt
    gtavvrssrvptgattqdaevddakygfvasgtlnpqkarvllqlaltqtkdpqqiqqif
    nqy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6eokB (B:)
    lpnitilatggtiagggdsatksnytvgkvgvenlvnavpqlkdianvkgeqvvnigsqd
    mndnvwltlakkintdcdktdgfvithgtdtmeetayfldltvkcdkpvvmvgamrpsts
    msadgpfnlynavvtaadkasanrgvlvvmndtvldgrdvtktnttdvatfksvnygplg
    yihngkidyqrtparkhtsdtpfdvsklnelpkvgivynyanasdlpakalvdagydgiv
    sagvgngnlyksvfdtlataaktgtavvrssrvptgattqdaevddakygfvasgtlnpq
    karvllqlaltqtkdpqqiqqifnqy
    

    Sequence, based on observed residues (ATOM records): (download)
    >6eokB (B:)
    lpnitilatggtiavpqlkdianvkgeqvvnigsqdmndnvwltlakkintdcdktdgfv
    ithgtdtmeetayfldltvkcdkpvvmvgamrpstsmsadgpfnlynavvtaadkasanr
    gvlvvmndtvldgrdvtktnttdvatfksvnygplgyihngkidyqrtparkhtsdtpfd
    vsklnelpkvgivynyanasdlpakalvdagydgivsagvgngnlyksvfdtlataaktg
    tavvrssrvptgattqdaevddakygfvasgtlnpqkarvllqlaltqtkdpqqiqqifn
    qy
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6eokC (C:)
    lpnitilatggtiagggdsatksnytvgkvgvenlvnavpqlkdianvkgeqvvnigsqd
    mndnvwltlakkintdcdktdgfvithgtdtmeetayfldltvkcdkpvvmvgamrpsts
    msadgpfnlynavvtaadkasanrgvlvvmndtvldgrdvtktnttdvatfksvnygplg
    yihngkidyqrtparkhtsdtpfdvsklnelpkvgivynyanasdlpakalvdagydgiv
    sagvgngnlyksvfdtlataaktgtavvrssrvptgattqdaevddakygfvasgtlnpq
    karvllqlaltqtkdpqqiqqifnqy
    

    Sequence, based on observed residues (ATOM records): (download)
    >6eokC (C:)
    lpnitilatggtiavnavpqlkdianvkgeqvvnigsqdmndnvwltlakkintdcdktd
    gfvithgtdtmeetayfldltvkcdkpvvmvgamrpstsmsadgpfnlynavvtaadkas
    anrgvlvvmndtvldgrdvtktnttdvatfksvnygplgyihngkidyqrtparkhtsdt
    pfdvsklnelpkvgivynyanasdlpakalvdagydgivsagvgngnlyksvfdtlataa
    ktgtavvrssrvptgattqdaevddakygfvasgtlnpqkarvllqlaltqtkdpqqiqq
    ifnqy
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6eokD (D:)
    lpnitilatggtiagggdsatksnytvgkvgvenlvnavpqlkdianvkgeqvvnigsqd
    mndnvwltlakkintdcdktdgfvithgtdtmeetayfldltvkcdkpvvmvgamrpsts
    msadgpfnlynavvtaadkasanrgvlvvmndtvldgrdvtktnttdvatfksvnygplg
    yihngkidyqrtparkhtsdtpfdvsklnelpkvgivynyanasdlpakalvdagydgiv
    sagvgngnlyksvfdtlataaktgtavvrssrvptgattqdaevddakygfvasgtlnpq
    karvllqlaltqtkdpqqiqqifnqy
    

    Sequence, based on observed residues (ATOM records): (download)
    >6eokD (D:)
    lpnitilatggtiavpqlkdianvkgeqvvnigsqdmndnvwltlakkintdcdktdgfv
    ithgtdtmeetayfldltvkcdkpvvmvgamrpstsmsadgpfnlynavvtaadkasanr
    gvlvvmndtvldgrdvtktnttdvatfksvnygplgyihngkidyqrtparkhtsdtpfd
    vsklnelpkvgivynyanasdlpakalvdagydgivsagvgngnlyksvfdtlataaktg
    tavvrssrvptgattqdaevddakygfvasgtlnpqkarvllqlaltqtkdpqqiqqifn
    qy