PDB entry 6eog

View 6eog on RCSB PDB site
Description: Human galectin-3c in complex with a galactose derivative
Class: sugar binding protein
Keywords: sugar binding protein
Deposited on 2017-10-09, released 2018-08-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-10-16, with a file datestamp of 2019-10-11.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: N/A
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Galectin-3
  Species: Homo sapiens [TaxId:9606]
  Gene: LGALS3, MAC2
  Database cross-references and differences (RAF-indexed):
  • Uniprot P17931 (1-137)
    • initiating methionine (0)
  Domains in SCOPe 2.08: d6eoga1, d6eoga2
• Heterogens: BKK, CL, SCN, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6eogA (A:)
  mlivpynlplpggvvprmlitilgtvkpnanrialdfqrgndvafhfnprfnennrrviv
  cntkldnnwgreerqsvfpfesgkpfkiqvlvepdhfkvavndahllqynhrvkklneis
  klgisgdidltsasytmi