PDB entry 6enp

View 6enp on RCSB PDB site
Description: Atomic resolution structure of human RNase 6 in the presence of phosphate anions in P21 space group.
Class: hydrolase
Keywords: RNAse k6, hydrolase, pancreatic ribonuclease
Deposited on 2017-10-05, released 2018-10-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-24, with a file datestamp of 2018-10-19.
Experiment type: XRAY
Resolution: 1.04 Å
R-factor: N/A
AEROSPACI score: 0.77 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonuclease K6
    Species: Homo sapiens [TaxId:9606]
    Gene: RNASE6, RNS6
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q93091 (1-127)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d6enpa_
  • Heterogens: PO4, ZN, NA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6enpA (A:)
    mwpkrltkahwfeiqhiqpsplqcnramsginnytqhckhqntflhdsfqnvaavcdlls
    ivcknrrhnchqsskpvnmtdcrltsgkypqcrysaaaqykffivacdppqksdppyklv
    pvhldsil