PDB entry 6eno

View 6eno on RCSB PDB site
Description: double cubane cluster oxidoreductase
Deposited on 2017-10-05, released 2018-03-14
The last revision was dated 2019-10-16, with a file datestamp of 2019-10-11.
Experiment type: XRAY
Resolution: 1.64 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dehydratase family protein
    Species: Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) [TaxId:246194]
    Gene: CHY_0487
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3AET9 (2-420)
      • expression tag (0-1)
  • Heterogens: BJ8, CIT, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6enoA (A:)
    gadnrelwkvlnvdlekhdeflapvpavyrelflnrpnrpramayfdavvgdihgirvhe
    lynlkqegkkvfatfcvyvpeeiinatgsaciglcggaqytvpagetvlprnlcpliksa
    mgfkiericpyfqvadyvvgettcdgkkkaweilneyipvyvmelpqkkeerdrkfweee
    ikdfaqfveektgvklnaenlragiekinkkrkalkrlsdlrkhnpapihgldvllinql
    affddperfatkvnelcdeleervakgegvvskdaprilitgtpqpiphwkihaliegag
    gvvvgeetcigeryfkdlvepaadvegmlkniaarslkvncacftpntgrledilsmvqk
    lqvdgvihyslqfcqpygvesylvgrelerrnipflklesdfseedqgqlktrieaflem
    i