PDB entry 6eni

View 6eni on RCSB PDB site
Description: Tryptophan Repressor TrpR from E.coli variant T44L S88Y with Indole-3-acetic acid as ligand
Class: transcription
Keywords: Ligand Binding, TRANSCRIPTION
Deposited on 2017-10-04, released 2019-02-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-06, with a file datestamp of 2019-02-01.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: N/A
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: trp operon repressor
    Species: Escherichia coli [TaxId:562]
    Gene: trpR, rtrY, b4393, JW4356
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A881
      • engineered mutation (43)
      • engineered mutation (87)
    Domains in SCOPe 2.07: d6enia_
  • Chain 'B':
    Compound: trp operon repressor
    Species: Escherichia coli [TaxId:562]
    Gene: trpR, rtrY, b4393, JW4356
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A881
      • engineered mutation (43)
      • engineered mutation (87)
    Domains in SCOPe 2.07: d6enib_
  • Heterogens: IAC, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6eniA (A:)
    maqqspysaamaeqrhqewlrfvdllknayqndlhlpllnlmllpderealgtrvrivee
    llrgemsqrelknelgagiatitrgsnylkaapvelrqwleevllksdlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6eniA (A:)
    aqqspysaamaeqrhqewlrfvdllknayqndlhlpllnlmllpderealgtrvriveel
    lrgemsqrelknelgagiatitrgsnylkaapvelrqwleevll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6eniB (B:)
    maqqspysaamaeqrhqewlrfvdllknayqndlhlpllnlmllpderealgtrvrivee
    llrgemsqrelknelgagiatitrgsnylkaapvelrqwleevllksdlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6eniB (B:)
    aqqspysaamaeqrhqewlrfvdllknayqndlhlpllnlmllpderealgtrvriveel
    lrgemsqrelknelgagiatitrgsnylkaapvelrqwleevllk